SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013933 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013933
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily EF-hand 2.05e-43
Family Calmodulin-like 0.00000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013933   Gene: ENSGMOG00000013036   Transcript: ENSGMOT00000014296
Sequence length 203
Comment pep:novel genescaffold:gadMor1:GeneScaffold_573:33722:34815:-1 gene:ENSGMOG00000013036 transcript:ENSGMOT00000014296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSKSGALSKEVLEDLKSNTKYSETELCTWYQCFLKECPGGKISRKQFEGIYASFFPNA
DPSAYARHVFRSFDTNADGTLDFKEYIVALHLTSGGKTLQKLEWAFALYDVDGNGTISKN
EIQEIVKSIFNMIPEEDQKGLPEDEDTPEKRSEKIWDFFGKKDNDKIAEGEFIQGVMDNK
DILRLIQYDEPQKIKDKLKEKRQ
Download sequence
Identical sequences ENSGMOP00000013933 ENSGMOP00000013933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]