SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013967 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013967
Domain Number 1 Region: 1195-1337
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-52
Family Phosphotyrosine-binding domain (PTB) 0.00000201
Further Details:      
 
Domain Number 2 Region: 174-300
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.25e-33
Family PLC-like (P variant) 0.032
Further Details:      
 
Domain Number 3 Region: 6-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-30
Family Dual specificity phosphatase-like 0.00016
Further Details:      
 
Domain Number 4 Region: 1059-1187
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-22
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013967   Gene: ENSGMOG00000013032   Transcript: ENSGMOT00000014330
Sequence length 1342
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3515:33240:73048:-1 gene:ENSGMOG00000013032 transcript:ENSGMOT00000014330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGYELDLTYITERIIAVSFPRACSEEIYAHNLKDVTRMLRSKHADNYLTINLSERRAD
LSRINSKTLDTGWPDLHAPPLDKICTICKAMEGWLNTDPLHVVVIHCRGGKGRIGVVISS
FIHFTDISASADQALDRFAMRKYYDDKVSALMTPSQKRYVWILNSLLSGSMKINASPLFL
HCIILHGLPNFDASGVCRPYLKVYQGMQAVYSSGVYHIGPGHRDRLCIPLEPAQLLKGDI
MIKCYHKSDVTSEREVVFRLQFHTGAVQGYSLSFERKTWRPPKDPRFPDYGRVELVFTEG
PERIPAVDADRWHNGADVMVDYNTADPILRWDSYQDICDGEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVNGDPGPGERETDILDDEVMM
TGHDLHSVDSLGTLSSSFHKSSQNSLLSDGFGSPGAEEPHHQHQNQQHIIHQHHPGSLPW
AGVGDDYETRRGFLANRSNSVASAAPGGGGGEQQLFRQGSYSTHSWVRQQQMVAAQQFGY
VGEDGGDNGPRFLACKPGSSPPKTGLPAEPQEGRATTAATRDEEFKSLTVDIDNSIDQLN
QLIMDLDPTFMPVSSRSGSVKRNGGVGNASPTNGTDQRLHSKSVTSLHHTQQTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAMLYRSDSVDYRAQGPDM
DSGIEAGSDIAPPTPSFPISPPTPYVKNMSEFTQFRQASYGVYRPEHGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEKKRASDGELSLGTASPVPSGFSSP
HSGSSLSIPFPNSLPDLSLQTQGVASPLPDVLSSRLVTVKFVQDTSKFWYKPDISRDQAI
SVLKDQEAGCFIVRDSHSFKGAYGLAMKVATPPPSVLQQSRRGGDLSNELVRHFLIECTQ
KGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPDRDPLEDVVESTSNSVTNSAAE
LLKQGAACNVWFLGSVEMESLTGIQAVQKATTRTLASDPLPTSTVVHFKVSSQGITLTDN
QRRLFFRRHYPVNMVIYCALDPQDRKWKKDGCPAKIFGFVARKTGNSMDNVCHLFAEHDP
EQPASAIVNFVSKVMIGSQKSK
Download sequence
Identical sequences ENSGMOP00000013967 ENSGMOP00000013967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]