SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013988 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013988
Domain Number 1 Region: 1083-1218,1275-1562
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.82e-110
Family Myotubularin-like phosphatases 0.00000443
Further Details:      
 
Domain Number 2 Region: 1721-1824
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-26
Family Pleckstrin-homology domain (PH domain) 0.00000631
Further Details:      
 
Domain Number 3 Region: 855-993
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000984
Family GRAM domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013988   Gene: ENSGMOG00000013054   Transcript: ENSGMOT00000014351
Sequence length 1827
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4383:38801:95269:1 gene:ENSGMOG00000013054 transcript:ENSGMOT00000014351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STGGAEGQGCIVQRFPEKDWEDNPFPQGVELFCQPNGWQLVPQRLPPSFFVAVLTDINSE
RHYCACFTFWEELDHPPKVAEASEVDEDGVLAAVPPAQLYGPKSLVLVSQLDHTEVFRNC
LGLIYTVHSDKLTAPLETVIGNLLSCVIPIAGGSQRTITLGAGDRQVIQTPIDDALPVSG
SSVAQLFRQLGIVNVLYLFCAALTEHKILFLSSSYQRLTDACRGLLAIMFPLKYSFTYVP
ILPGKLLEVLSTPTPFIIGVNSFFRSETQELLDVIIADLDGGTVTIPECVHISLLPEPLL
QQTMTALSMVLDPELELADHAFPPASIQPSALKIQDKEIRGVFLWLFARLFQGYRWCLHI
IRIHPEPVIRFHKAAFLGQRALSEDDFLMKVLDGMAFAGFVSERGPPYRVTDLFDVLVAN
QVERIRQEEACPQKVMNHVKELAEQLFKNXXXXXXXXXXXXXXXXXXXXXXXXNPAPFPL
LDDVTVQLFVDHAASKQRSAPPAVKAEVKAMVPSGPPLGDVVDRHGSVLANSARRLEVVR
NCITYIFENKMLEAKKLMPAVLRALKGRAARVCLTQELNQHVLQNRAVLDDQQFDYIVRM
MNCTLQDCSHMDEHGIAAALLPLVTAFCRKLGSGITQFAYSCVQEHMVWTNMQFWEAMFY
SDVQNHIRALYLEGEEGTPEPSSGGGQEVSALDLASEQNRLWPTLTKDMQSERVQKEEST
VFSQAIHYANRMSYLLLPLDTSKNRLLRTGGLGDVESVSNSYVTNSIAGSMAESYDTESG
FEDAETSDVANSVVRFINRFVDKVCNESGVTNEHLKALHTMIPDIVQMHIETLDAVHRES
KRLPPIQKPKLLRPALLAGEELVMEGMRVHLISDGREEATGCMGGPALLPAEGAVFLTTY
RLIFKGTPTDPLVGEQIVTRSFPIASLTKEKRISVSLPLDQYIQEGLQLRSCTFQLMKIA
FDEEVASDLAEVFRKHVHKLRYPQHVQATFAFTVGQAAKMVVEHKSKDKNQSLKTLSKHL
VKTAKRTIGRQYVTRKKYAPPTWENRSSLQSELDEDEISVSEEMDQTSLTLSSTMRSSDR
QTMSNVVERACCRDYQRMGLGTLSNSLTRSKNEPFRISTVNRMYTVCRSYPGLLIVPQSI
PDSTLQRICRCYRQNRFPVVCWRNSRTKAVLLRSAGFHAKGVVGFFKSPNATSSVPSQAD
SSSLEQEKYLQAIITSMPSYGETPGRNTLSGFISPHMRSSGKWGSIRGSGRLSAYNADVG
NRLAGKESPHLNGAAGDALFLRQPRAYLYIIGDKGPLKGVKQDPLQQWEVIPSEVCDVRQ
VKNSFKKLMKACVPSSVSADAALSFHHCLQDSEWMSLLNKVLQVSVLVVELLDKGSSVMV
SLEDGWDVTTQVVSLVQLLSDPYYRTFDGFRLLVEKEWLSFGHRFSHRGAQTLASQSSGF
TPVFLQFLDCVHQIHLQFPMEFEFSQYYLKFLAYHYVSNRFRTFLLDSDYERIELVGVLY
EEKGERKAPQVCKSVWDYIDRLNKKTPVFYNYMFSPRMRRVLRPYSHISNMKLWDFYTEE
TLSEGPSFDWELGRSRPERPAEAGGGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPSASTSALYSQFQSTESDNRSFEGILFKRGALLKPWKP
RWFVLDKTKHQLRYYDSRQDKECKGVIELGEVESVIPGTPTMGAPKNIEEKAFFDLKTTK
RVYNFCAQDSLNAQLWMDSVQSCLSDA
Download sequence
Identical sequences ENSGMOP00000013988 ENSGMOP00000013988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]