SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014001 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014001
Domain Number 1 Region: 1864-2100
Classification Level Classification E-value
Superfamily Plakin repeat 6.8e-76
Family Plakin repeat 0.0000000355
Further Details:      
 
Domain Number 2 Region: 2178-2218,2267-2463
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-67
Family Plakin repeat 0.000000186
Further Details:      
 
Domain Number 3 Region: 1624-1855
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-61
Family Plakin repeat 0.00000752
Further Details:      
 
Domain Number 4 Region: 664-780,807-834
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000104
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 144-271
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000115
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 6 Region: 2115-2172
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000418
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 7 Region: 2-85
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000023
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000014001
Domain Number - Region: 590-698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0208
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014001   Gene: ENSGMOG00000013073   Transcript: ENSGMOT00000014364
Sequence length 2518
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3515:81971:101840:-1 gene:ENSGMOG00000013073 transcript:ENSGMOT00000014364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFNDAMGWIGQQKRLIETAPWGDDAEALDQQTISHNKFHNSIQRSVEVDRARDELNMSRD
KPRLNTLEQEWSSLQKMSDKRFSELRELQGIIEEISRAIMWVNEREEEELVFDWGDKNIE
QYIPRKQEGYSKMMSALEEKEKELNKLKTKVDGLLNKNHPASDKIEAYMDTLQTQWSWLL
QITKCIHVHLKENAAYHQFFKEANETYGKLQKQHEHVRNKFTCDKQTSLESLLDLLKDLE
VKEKIMENKRQVQSLVTKSKSIVRLKPRNPEERSSSTVMVQALCDFKQDQKSILKGNEGI
LKDNSQRSKWQVTGPGGLDMLIPSVCLLIPPPNPLSIGLANKNEQYYEAIMGIWNQLYIN
IKSLIAWQYCSQDINYINSLTLTMLSKMRPDEYRTVIKRLETHYQEFLRTSQGSELFGEE
EQKNIKGQFAFAQNHYDGLIVQLPTYTSESTGPSLKPTKVTKVTAPPPAPAPSTLSLSLL
NDLDALRRRLEVTESSLTYHLHLPLGENSVRECSLNLQKLQVVSKDLDALHDEYIRLRER
ILKQLDGIPADSEQAKYLRSQLDYINLRIGDLQGLNNSYFNRLSCLKGVLQNMNQVQDVV
QVNEVLLTEKDTTSLDTREVDEYRSTLKQMRLELDQKRDLLSAMDSELASAVQYNSQISR
NFHKCDVDLTKYAEQVGQLNDRWSRIRSQIDSRVWDLEKQDKELRDYHKSSGNLETWIDN
TRIRQDSLQTVKFTDIPALMDHLNQQKVLYNEIKGKHEKVEDVQKDAEICASSIKDYELQ
LASYSAGLETLLNVPIKRTMLKSPASTVRQEATVLHSSYVELLTRSGDYHKFLGEMLKSM
EELKMRNTRIELLEEELRRLKESFQDRNHKNQSLEDALARYKLELSQSKEKLISLEEVKM
TSVIQVNATRESLDSTQNQLKDLNDKLSRLQYQLDEEVRKRRLAEERYTSQQEEYESAVR
RRQKELEEVNWSKIDLEKLVKDKERELERLKIQLEEEAARRRGAESEMSKVRTQHKQEVS
QLRQTFETEIHVTKTSVQLSSQQKEEDATEARLICDRLTDEKRDLEEELRRLRLSIAQRD
EQKGKAEQEVLQQRERMTEEVRRRSEIEVQLRTLVQRSGEDDLRLQEAHSSNQELTRKIS
LLKQSLQEEERKRRGFEMEISQLREVQTELQMKNKAHIDAMNKLQASEQERSVIHLQLEK
TTSSKTQAEQSAARLQSHTQELQCALDNMESQLQKQKMAYQEEFTCRKRLDAELERTKNS
CREHTTTIASLRSIQEEASNCERRYSMDVKTLQEALDKSVRDLRLTTDKLNQMAEELKQV
KKQLLEEQSRYRELNQRSESLYKTIEEKTRLLNESTTEVNRLKSQTQSITKERLRLEEEL
RTTKQDRDDLRANTESVDEESRNQIRALHLQLQSSSKRTMELEAFINDLTKEREKLKLEI
DKIQKQSIETSMMIHESKSSFTELKQEREGLLSKMKMMEQDKIRQQRIEEELTRIKLSLE
TELRNKQRLTEENTSVRKDLAYFKSQFELRDSEKRQGDSDRDRADRERASMKSEVERLTR
ELRTLEETYKSQRLISEKESREMTLRRQTLEKEILMLQQRPSSLSRQTQTSEKVSTIDPS
KLLFDGVRRKVTAHQLCDCGIISKSTLEMLLSGRKTVEEVAVDIQISLKGTGIIAGMTRG
AQGKMPFTEAKTKGQLSRECALMLLESQAATGYIVDPAFNEKMPVDTACTRGLVDAEDRD
VLLTAEAASTGFKDPFSGKLLSVGQVLKQGRIDKPTAIRLLQAQESVGGIIDPVLGVFLP
KDLALDRNLIDEDLYMTLNKKPACYLDPTSGKKINYSDLKLKCKIDSVSGLLLLPGGKEK
CMTVKGIRSEVTMTELVASDLLSTADLEKVYQGTLTSQDIEDRLKNYLYGSSCIAGIYDE
AKDRTMSFYMAMKEGLIMRGTTLELLEAQAASGFIIDPVNNVFLTVEEAVKRGVVGNEFK
KKLISAEKAVVGYTDPETGNTISLFQAIDKDLIEKGHGIRLLEAQIASGGIIDPKESHRI
DVDVAYRRGYFNKEMNEILTYEGDDTKGFFDPNTKDNLTYLQLKERCIKDPKTGLVLLAL
RDKSKKPKDFSESRKNVLRKRRVVIVDPDTGLEMSVREAFHRELIDYDTFLDLSEQECEW
EEITVKGEDGSVRVLLVDKKTGTQYDINEYLERGAIDQASLDRYRSGNITLTEFADLITQ
KSSSREMSITASTADDVATCTSPTQARPSSPTVRKRFNSISITLSPAEMFDDLSPVGAIF
DTETLEKITISEACRRGIVDNITAQRLLEAQASTGGIINPSTGQRLSLQDAVHQTIIDED
MAPKLKASQKAFTGFEDVKSKRRMSAAEAMKEKWLPYEAGQRFLEFQYLTGGLLEPGSGR
RISMEEAIRRKWLDGREAQKLQDTQNHQKNLTCPKTKLKISYKQAMDGCMVEESNGMKML
QATSISSKGISSPYNVSNPGSRSGSRQGSRAGSRRGSVDYSSSYSLCLFFFCNRSFSN
Download sequence
Identical sequences ENSGMOP00000014001 ENSGMOP00000014001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]