SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014016 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014016
Domain Number 1 Region: 468-642
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.69e-51
Family G proteins 0.0000206
Further Details:      
 
Domain Number 2 Region: 6-69
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000433
Family Calmodulin-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014016   Gene: ENSGMOG00000013096   Transcript: ENSGMOT00000014379
Sequence length 664
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2134:140962:150002:-1 gene:ENSGMOG00000013096 transcript:ENSGMOT00000014379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FECSTMDVPSLQRLFSACDVNKSGDIEYEDFTVVCRELHVPENEIKTLFNKFDADRDGYI
NYTSFSSKFQEVSETLDLSSFAAVESSHGQICPWDEFLDRNDAIPLLSESLRTKLSGLYQ
AIVDSSNSPLLTHYEVVINSLISESIDHKMETTQLETSLKRTEDMNTSQLEELEEDLQKQ
LAAVELRVRDQEHKKMEEMVASMQRRHDNQVADLHASLERLKKSQEDSKLDRTKDDVTRL
ERNVFELTQENERLQSSLLAAQTDVSVLHLELDKLKNMYTDQGLQHHREQDDLKRMVEEY
QSYTNQIQALQETNKKLYDSNDGLRSALANEAAVATKRRCVSMCAIQLSPKNEIPARRMK
PIRQSTINHGRYVVADQSQPGAPPYQHVARWADKYLDSGVAMPEDASPRSMETVHHSYSY
IQSDMEISEVKSEAAMSIPRPWARSLALSLRRRLSAFSTKDVLEEEGPSPIYRLVLAGDA
GSGKSSFLMRLTLNEFRTDMQTTLGVDFQMKKLLVDGEKTTLQIWDTAGQPRFRCIARSY
FRKANGVLLLYDVTSESSFLNVRAWMEQIQDSTEGQIPMCIIGNKVDLREERPVGCVSTA
HGEKLASVYGALFCETSAKEGTNVVEAVLHLAREVKKTIVVRDQSESEVRLSSSSPKRTL
TECC
Download sequence
Identical sequences ENSGMOP00000014016 ENSGMOP00000014016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]