SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014029 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014029
Domain Number 1 Region: 476-564
Classification Level Classification E-value
Superfamily Moesin tail domain 1.96e-29
Family Moesin tail domain 0.00003
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-17
Family First domain of FERM 0.00012
Further Details:      
 
Domain Number 3 Region: 195-309
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000281
Family Third domain of FERM 0.000045
Further Details:      
 
Domain Number 4 Region: 152-194
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000236
Family Second domain of FERM 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014029   Gene: ENSGMOG00000013113   Transcript: ENSGMOT00000014392
Sequence length 564
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2356:121563:135891:-1 gene:ENSGMOG00000013113 transcript:ENSGMOT00000014392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVTTMDAELEFSFNPNTTGKQLFDQVARTIGLREIWYFGLQYLDNKGFQSWLKFDKK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDQHKMSKDQWEERVQTWHNEHGSMVK
EEAVLEYLKITQDLEMYGVNFFEIKNRKSTDLWLGVDALGLNIYGKADXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDFVFYAPRLRVNRCILQLCMGNHELYMRRRKPDTIEVQQ
MKAQANEEKLQKKIERVNIHVGQRQSGGRDLMTRLAQYEETTKKAERDLQEQLERGLRLE
EERRRVEQEAARLETERMEAIIAKEELLRQAADQMNSQEQLSLELAEFSAKIAILEEAKR
SKEEEADSWQNKAREVEEDLCRTKEELHSVMTSPTVLAPVAGSESDHEEHNEENSSYSAE
LQPQENADHRREEERLTEADKNERLQRQLQALSSELAHARDDTKKTSNDLLHSENQREGR
DKYKTLRQIRMGNTKQRVDEFEAL
Download sequence
Identical sequences ENSGMOP00000014029 ENSGMOP00000014029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]