SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014089 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014089
Domain Number 1 Region: 234-385
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-31
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 23-129
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 3 Region: 636-705
Classification Level Classification E-value
Superfamily Ras GEF 0.00000000000196
Family Ras GEF 0.0069
Further Details:      
 
Domain Number 4 Region: 486-593
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000159
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014089   Gene: ENSGMOG00000013163   Transcript: ENSGMOT00000014452
Sequence length 710
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2134:275197:287534:1 gene:ENSGMOG00000013163 transcript:ENSGMOT00000014452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGLRLNDGHVTYLGLLAKKDGTRRGSLSKKSSDNTKWHTKWFALLQNMLFYFENESSS
RPSGLYLLEGCVCDRAPSPKPSLSAKDCLEKQYYFTVNFTHENQKALELRTEDVKDCDEW
VASISHASFRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEISG
LLKDNEKTQSSPPAAPSDDDDDAELKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESM
RKRNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMF
LHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDK
LLKQYEAKPDCEERTLETFLTYPMFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQARVPGSLIQVPMSEKGKI
TRGRLGSLSLKKEGERQVFLFSKHLIICTRGSGGKLHLSKNGVVSLIDCTLLEDPEGTDD
EPKTDKSGQDLEHLDFKIVVEPKDLQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLM
MNAFEDNSKVTVPQMIKACVLCTVLPGRSDTSLYCDDVDIRFSKMMNSCKVLQIRYASVE
RLLERLTDLRFLSIDFLNTFLHSYRVFTGADVVLDKLITIYKKPISAIPA
Download sequence
Identical sequences ENSGMOP00000014089 ENSGMOP00000014089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]