SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014163 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014163
Domain Number 1 Region: 57-256
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 5.49e-40
Family Nicotinic receptor ligand binding domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 256-320
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0000000000000101
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000014163
Domain Number - Region: 15-46
Classification Level Classification E-value
Superfamily Plexin repeat 0.0492
Family Plexin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014163   Gene: ENSGMOG00000013158   Transcript: ENSGMOT00000014527
Sequence length 320
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2965:13424:17041:1 gene:ENSGMOG00000013158 transcript:ENSGMOT00000014527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNACINMLFMCLYVCMNRTTLSKCASSTRPVCVWGGVAEDCSYASLFKHLNLNNKTDSQV
HLRPVRNWTTPTVVRVNMVVYGIIEVNEKAQTFTVQTWRSTEWKNEFLSWDPKRFCGIWV
MGVPRGMMWVPDIYIHEDTSDNGATLYSRHLQLLYDGSVTSMAKGELKAICQMNLYHFPV
DVQRCNISFGPFSLFGNHPRHISILINQYSSSSRDTHMATNGEWEMTRIAVYSGFDTYNE
IKVPRLSYQITLKRRPMLYIINCILPLFYFLMLDVGTFFISEARGEKLSLKVTLLLSISV
LLLILQDILPSTSDQLPLIG
Download sequence
Identical sequences ENSGMOP00000014163 ENSGMOP00000014163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]