SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014174 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014174
Domain Number 1 Region: 493-659
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 4.71e-70
Family A middle domain of Talin 1 0.000000145
Further Details:      
 
Domain Number 2 Region: 757-893
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.55e-51
Family I/LWEQ domain 0.00000116
Further Details:      
 
Domain Number 3 Region: 664-787
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.19e-50
Family I/LWEQ domain 0.00000192
Further Details:      
 
Domain Number 4 Region: 2299-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.96e-50
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1849-1977
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.04e-40
Family VBS domain 0.00000327
Further Details:      
 
Domain Number 6 Region: 1230-1365
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 7.06e-38
Family VBS domain 0.022
Further Details:      
 
Domain Number 7 Region: 200-313
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-34
Family Second domain of FERM 0.000000978
Further Details:      
 
Domain Number 8 Region: 314-404
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 9 Region: 1472-1558
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000327
Family I/LWEQ domain 0.0075
Further Details:      
 
Domain Number 10 Region: 2011-2137
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000439
Family VBS domain 0.019
Further Details:      
 
Domain Number 11 Region: 1080-1147
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000345
Family VBS domain 0.08
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000014174
Domain Number - Region: 925-987
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000188
Family I/LWEQ domain 0.0049
Further Details:      
 
Domain Number - Region: 1698-1811
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000251
Family alpha-catenin/vinculin 0.053
Further Details:      
 
Domain Number - Region: 1603-1663
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000353
Family VBS domain 0.084
Further Details:      
 
Domain Number - Region: 89-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00479
Family First domain of FERM 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014174   Gene: ENSGMOG00000013216   Transcript: ENSGMOT00000014539
Sequence length 2546
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3803:10217:54764:1 gene:ENSGMOG00000013216 transcript:ENSGMOT00000014539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNKRTATMVALSLKIGVGNVVKTMQFEPSTMVFDACRIIRERVPEAQLGQPNDYSLFLSD
EDPKKGIWLEAGKALDYYMLRNGDTLEYKKKQSPIRMLDGTIKTVMVDDSKIVSDMLMTI
CARIGITNYDEYSLVRDMGEEKKEETMGTLKKDKTLLRDDKKMEKLKQKLHTDDELNWLD
HGRTLREQGVEEIEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKA
CEFAGFQCQIQFGDHNEIKHKPGFLDLKEFLPKEYIKQKGEKRIFQAHKNSQNMTEIEAK
VSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTN
IKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDE
ESTMLEDSVSPKKSTVMQQQFNTMGRVETGSVALPAIMRSGAGGPENFQMGSMPQAKQHI
TSGQMHRGHMPPLTSAQQALTGTINSSMQAVNAAQASLDGFDTLPVLGTDAASQAWRRNK
MDESKHEIHSQVDAITAGTASMVNLTAGDPADTDYMAVGCAVTTISSNLTEMSKGVKLLA
ALMEDEGANGQQLLGAAKNLATAVSTMLKTAQPSSTEPRQNLLQAAGNVGQTSGELLSHI
GETDADPHFQDMLMQLAKAVANAAAALVLKAKNVAQKTEDSAQQNRVIAAATQCALSTSQ
LVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASQGATGDEVLLKQVGAAATGVT
HALNELLLHIKQYASGAHPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSD
LVNAIKMDAEGESDLENSRKLLSAAKLLADATAKMVEAAKGAAANPDSEEQQQKLREAAE
GLRIATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNRNAASQQQLVQSC
KVVAEQIPQLVQGVRGSQSQPDSPSAQLALIGASQNFLQPGAKMATSAKATVPTIGEQAS
AMQLSQCAKNLASALAELRTAAQKAQEACGPLEIENALSVIRGLERDMQEAKASAGAGRL
KPLPGETLEKCSQDLVSSTKSVSSAIAQLLSEATQGHENYTGMAARDVAQALRSLASAAR
GVGATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAKAVSQAL
NRSVNSLPGQRDVDNAIRAVGEASKTLLADSFPSSGKSFQEVQAQLNQAAAGLNQSANEL
VHSSRGTTQELARSTSKFGGDFNNFLEAGVDMAGTSQTKEDQTQVVSNLKTISMSSSKLL
LAAKALSTDPGSPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELESVREM
LENPTEAVSDLSYFDCIDRVMENSKVLGESMAGISHNAKNSNLPEFGDSVSAGSKAVCGL
TEAAAQAAYLVGVSDPNSTAGQKGLVDPSQFAKANQSIQMACQNLVDPICTQSQVLSAAT
IVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNPENRE
KCKAATGPLIEAVDNLTAFASNPEFASVPAQISPEGLASMEPIVAAARTMLESSTGLIQT
ARSLAVNPKDPPRWSVLASHSRTVSDSIKKLITNMREKAPGQRECDEAIDVLNSCIREVD
QASLAAISQQLSPREDISQEALQEQMMTSVHEISNLIEPVAIAAHSEASHLGHKVSQMAR
YFEPLIMAAIGTASKIVSSQQQMAVLDQTKTLAESALQMLYTAKEAGGNPKQAAHTQEAL
EESVQMMKEAVDDLGATLSEVAGAAGAVGGMVDSITQSINKMEDPNVGDPDGNFVDYQTT
MVRTAKAIAVTVQEMVTKSNTNPDDLGGLANQITNEFGDLANEAKYAAITAENEEIGSHI
IKKVGELGFSCTGLVTKAGALQCSPNDMFTKKELIESARKVSEKVSHVLASLQAGNRGTQ
ACITAASAVSGIIADLDTTIMFATAGSLNRENSETFADHREHILKTAKALVEDTKLLVSG
AGASQEKLAQAAQSSVLTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALSDLIR
ATKGAAGKPHDDPAMLQLKNSAKVMVTNVTLLLKTVKAVEDEATKGTRGLEATIEHIKQE
LAVFNSPDPPPKTATPEEFIRKTKGITMATAKAVAAGNSCRQEDVIATANLSRCAIADML
HSCKQAAYHPEVNQDVQLRALRYGKESAVGYLALLEHVLVIIQKPTPELKQHLAIYSKRV
AGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLRPRTKPKEAD
ESLNFEEQILEAAKAIAAATSALVKAASAAQRELVAQGKVGVIRANAVDDGQWSHGLISA
ARMVAAATSNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRL
QAAGNAVKRASDNLVKAAQKAAFDAQDDQAVVVKSKMVGGIAQIIAAQEEMLRKERELDE
ARKKLATIRQQQYKFLPSELREDGQD
Download sequence
Identical sequences ENSGMOP00000014174 ENSGMOP00000014174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]