SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014186 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014186
Domain Number 1 Region: 25-140
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-33
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 2 Region: 113-206
Classification Level Classification E-value
Superfamily EF-hand 0.000000000424
Family Calbindin D9K 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014186   Gene: ENSGMOG00000013265   Transcript: ENSGMOT00000014551
Sequence length 212
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1468:30139:32020:-1 gene:ENSGMOG00000013265 transcript:ENSGMOT00000014551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCTMLLAVLSWLCTSLLVSVRGGKLPEAEVNIEVLHRPFLCHRKSKYGDILLVHHEGYFQ
NGTMFHSSYTEGDKQAVWFTLGIREVIIGWDKGLQDMCSGEKRRLTVPPSLAYGKEGRGK
IPPESTLTFVIEVMEIRNGPRSHESFQEMDLNDDWKLSKEVKEYLRKEFQRHGYPPNDTH
HESMVEDIFVKEDENKDGFISSREFTYKHDEL
Download sequence
Identical sequences ENSGMOP00000014186 ENSGMOP00000014186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]