SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014258 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014258
Domain Number 1 Region: 104-207
Classification Level Classification E-value
Superfamily Immunoglobulin 2.63e-17
Family C1 set domains (antibody constant domain-like) 0.08
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000264
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 291-379
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000114
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 376-471
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000037
Family I set domains 0.052
Further Details:      
 
Domain Number 5 Region: 204-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000625
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014258   Gene: ENSGMOG00000013317   Transcript: ENSGMOT00000014626
Sequence length 743
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3150:659861:712302:1 gene:ENSGMOG00000013317 transcript:ENSGMOT00000014626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQGEAMFSQQPQDLVVVAGQPVTLPCSIPGYNGVVLWIKDGLALGVGRDLSGYPRYTVIG
DHSTGEHHLRIQRVELMDDAIFECQAIQAAMRSRPARLTVLVAPEDPVISGGPVVSLRAG
DPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGRRESTVSTLYLSPTNMETGQ
QIICKASNKAVPNGKETSVTIDIQHLPLVNLSVEPQPILEGNLVKFHCSAKANPPVTLYR
WAKGGSVIKEVSGDTYEVIVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRMAAEPQS
LQVDLASDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVP
RVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPPDRIAWSWKETVLESG
TSGRYTVETVSTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGGSQVD
SLWVSAESLPVAVIIGVAVGAFVAFIVVMGTVGAFCCTRSQRNHKGAASAKNDIRVEIVH
KDHNAARESEDHASMKQLMVERGDFQQESVLKQLEVLQEEEKEYQHIKDPTNGYYSVNTF
KEHHTPTVAGNPPAEASRNPTGASTLGKQRVPTGMSFTNIYSTLGAGPNRLYDYSQRFVL
GMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSYSKQDGYVQFDKDSKASAASSSSH
YSQSSSQNSDLTKPLQKRMQTHV
Download sequence
Identical sequences ENSGMOP00000014258 ENSGMOP00000014258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]