SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014303 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014303
Domain Number 1 Region: 53-289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.0000312
Further Details:      
 
Domain Number 2 Region: 288-415
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-33
Family Pleckstrin-homology domain (PH domain) 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014303   Gene: ENSGMOG00000013360   Transcript: ENSGMOT00000014673
Sequence length 951
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1112:107100:127175:-1 gene:ENSGMOG00000013360 transcript:ENSGMOT00000014673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGEMDETDAFRKRADDTVSLAPSTTESILVEDVHYVAVRAELEADAQDLEAESWSLSVD
QQCVKKYSKEMVKRQDVIYELMQTEMHHVRTLKIMLCVYVRELKENLQMEPSKLDCLFPR
LESLLDLHTNFLSRLKERRRDCLLAPGERNYFINRLADVLIGQFSGEIGEKMKESYGDFC
SSHLEAVSFYKEQLQNNKKFQNLMRKINNFPIVRRLGVTECVLLVTQRITKYPVLVERIL
QNTEXXTEEHEELTRALVLIKNGIVQVDALVNLHEKTLRLRDIHGRMEPKALGKIKDGRV
FRREDLAPGGGLLHTGTVHWKAASGRLKDILAVLLSDVLLLLQEKDQRYVFAMVDNKPSV
ISLQKLIVREVAHEEKAMFLICASSKEPEMYEIHTSSKEERNTWMSLIRQAMESCPHTEG
RLFSEEEEARAVRFKEFQDRLNQKDALVVHALTEKLQLFAEMAETTAGLEDTASRSRLLL
RGDASDLQQGEALLKGAITEVENLQNLLQSGVREDSSSPRLEAGGSSGNLPRRAGTFGGY
DRSPSILPKNCSVRRNKARSRDRSQRARSDPQLKDLSGSHTQEHAXXXXXXXXXXXXXXX
XXXXXXXXXFFDRVLMLSQRLYSLQAIISQQDSHMELQRASLTERASLPGRHGGNILLEQ
EKQRTLALQREELASFHKLQAQHRLEQQRWEKERQRHRQQVEATEARLHQREEECARLEE
RLREEREELELQRKTYQQDLERLRESTRTVEREKERLEHQRKIKRKTIEVKPLGRSSMSM
APADFQERPESSLRREASSAGTPAAKTEVPLHLFSTTNQQHKVLGFQQQIPTKLAVLSRK
DKNTKSMKASHRSDSSASLDTRQMLPLKLSARDDSSLKARRSVSPHQPSPPAPPRPPPPP
ARLSPPRAPGHPTTTARPRRPAPRHRAAATQGVSPPYGFPSKEDKEDVIFF
Download sequence
Identical sequences ENSGMOP00000014303 ENSGMOP00000014303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]