SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014320 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014320
Domain Number 1 Region: 141-213
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000000269
Family Polyphosphate kinase C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014320   Gene: ENSGMOG00000013379   Transcript: ENSGMOT00000014690
Sequence length 251
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3229:109311:134939:1 gene:ENSGMOG00000013379 transcript:ENSGMOT00000014690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQQKCIMIFALVCCFAVLVALIFSAVDIWGEDEDGITEENCSRTCRVPLVYTLPGEPRNN
LPPDPLSLPLSLWWYGAMDTLLQGQHSISRPWLLQKTRLRLQHQQHCNQKTYNLFSLQIS
LSLSSPLSLPPSLSPPPLPLGADIHYLNTTALIRGQLHASFWVVDRKHLYFGSATMNWRS
LATRKELGVLVYDCSCLALDLHKVFSLYWGLQYKDFIPSFWSKRVFALYNRDSPLDLTLN
STKAQAYISVS
Download sequence
Identical sequences ENSGMOP00000014320 ENSGMOP00000014320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]