SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014414 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014414
Domain Number 1 Region: 569-935
Classification Level Classification E-value
Superfamily Ras GEF 7.32e-96
Family Ras GEF 0.0000000000408
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 5.14e-54
Family TBP-associated factors, TAFs 0.000000297
Further Details:      
 
Domain Number 3 Region: 198-400
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-38
Family DBL homology domain (DH-domain) 0.0000000266
Further Details:      
 
Domain Number 4 Region: 418-575
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-36
Family Pleckstrin-homology domain (PH domain) 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014414   Gene: ENSGMOG00000013471   Transcript: ENSGMOT00000014787
Sequence length 935
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4053:5415:24433:1 gene:ENSGMOG00000013471 transcript:ENSGMOT00000014787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPAQTHYDFFNEENSPKWRGLLVPSLNKVLSQVHPKLSSQQEALQYIEELILLLLSMLC
AAQPRTVQDVEERVQKSFPHPIDKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KVDHQVSLYMVAVLEYISADILKLAGNYVRNIRHYEISQQDIAVAMCADKVLMDMFHQDE
EVLGGFCSLEEEVCVSEEQTYYDLVRSLMTEGRLYLRQLNLTIKIFREPFCGNPTLYSQQ
DVDSIFSRIVDVQEVTVKLLGLLEDTVEMTDEGNPHPLVGSCFEDLAEELAFDPYETYSQ
DILRPEFHDHFLCQLSKPGAADYLQSICDGFKEAVQYVLPRLLLTPVYHCLHHFETLKQL
EEKSEDEEDKECLKQAITALLNLQGSMERICTRNLAKRRLSESAGRFYSQQMRGKPVAIR
KMNEIQKNIDGWEGKDIGQCCNQFIMEGPLTRVGAKHERHIFLFDGLMICCKLNHSVPRL
PSSGSPAEYRLKEKFLMRKVHINDKDDREGEYRHAFEIVLKDGNSVVFAAKTAEEKNGWM
AALISLQYRCTLERMLDSAMLQEEKEEQMRLPRAETYRFAEPDSEENVVFEENVQSKSGI
PIIKAGTVLKLIERLTFHMYADPNFVRTFLTTYRSFCRPQQLLGLLIERFEIPEQRRRGR
SGAGEPLLSAELKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDAELLRRLEDFIALVR
GKPMKKWVESISKIILRKKQASGPSLNPPLQSSAPNITFQNSPPPVEWHICRPGQSEHFD
LLTLHPIEIARQLTLLESELFRAVQPSELVGSVWTKEDKELNSPNLLTMIRHTTNLTLWF
EXXXXXXXHLDERVAVVGRIIEVLQVFQELNNFNGVLEIVSAMNSSPVYRLDHTFELISG
RQRRILEEAHELSEDHYRKYLAKLRSINPPCVPFF
Download sequence
Identical sequences ENSGMOP00000014414 ENSGMOP00000014414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]