SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014426 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014426
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily EF-hand 1.49e-55
Family Calmodulin-like 0.0000000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014426   Gene: ENSGMOG00000013498   Transcript: ENSGMOT00000014800
Sequence length 192
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1523:182560:192348:-1 gene:ENSGMOG00000013498 transcript:ENSGMOT00000014800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGNLSMEEFKKIYGNFFPYGDA
SKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEM
LEIVQAIYKMVSSVMKMPDDESTPEKRTEKIFRQMDTNRDGKLSLEEFIKGAKSDPSIVR
LLQCDPSSAGQF
Download sequence
Identical sequences ENSGMOP00000014426 ENSGMOP00000014426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]