SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014432 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014432
Domain Number 1 Region: 559-927
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.94e-113
Family Hect, E3 ligase catalytic domain 0.0000000000107
Further Details:      
 
Domain Number 2 Region: 19-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-17
Family PLC-like (P variant) 0.00068
Further Details:      
 
Domain Number 3 Region: 463-502
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000128
Family WW domain 0.0004
Further Details:      
 
Domain Number 4 Region: 394-427
Classification Level Classification E-value
Superfamily WW domain 0.000000000000312
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 505-542
Classification Level Classification E-value
Superfamily WW domain 0.00000000000668
Family WW domain 0.00057
Further Details:      
 
Domain Number 6 Region: 363-393
Classification Level Classification E-value
Superfamily WW domain 0.00000000086
Family WW domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014432   Gene: ENSGMOG00000013486   Transcript: ENSGMOT00000014806
Sequence length 933
Comment pep:novel genescaffold:gadMor1:GeneScaffold_452:45573:71731:-1 gene:ENSGMOG00000013486 transcript:ENSGMOT00000014806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASRAESSHNHGESSQLHAIISCAKLRRKKSLFGSIYVEVTADGETRRTAKTHSSSNP
KWDERLALNVSPQSEVDFKVWSHHTIKADSLLGKATLNLRQVLDQHERKLENVKEVLKLS
VEQKGAAVSTGELTVYLDGLTVADQEAVQPLTNGETQQNGDAIHENGEDLSSSSRAANXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRIYYVDHNTRTTT
WQRPTMESVRNFEQWQSQRSQLQGAMHQFNQRYLYSASMMSAENDPLGPLPPGWERRVDS
NDRVYFVNHSTKTTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFNDPR
TGKSSVTKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKP
YDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTI
NPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLNKKLLLKDLESIDPEFYNSLIW
IRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMAEWRFSRGV
EGQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQII
WFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKETWLPRSHT
CFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences ENSGMOP00000014432 ENSGMOP00000014432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]