SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014467 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014467
Domain Number 1 Region: 3864-4098
Classification Level Classification E-value
Superfamily Plakin repeat 4.19e-87
Family Plakin repeat 0.0000000355
Further Details:      
 
Domain Number 2 Region: 2955-3194
Classification Level Classification E-value
Superfamily Plakin repeat 5.36e-80
Family Plakin repeat 0.000000164
Further Details:      
 
Domain Number 3 Region: 3286-3525
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-78
Family Plakin repeat 0.000000307
Further Details:      
 
Domain Number 4 Region: 3623-3857
Classification Level Classification E-value
Superfamily Plakin repeat 4.36e-76
Family Plakin repeat 0.000000496
Further Details:      
 
Domain Number 5 Region: 2629-2868
Classification Level Classification E-value
Superfamily Plakin repeat 3.27e-73
Family Plakin repeat 0.000000536
Further Details:      
 
Domain Number 6 Region: 61-234
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.2e-57
Family Calponin-homology domain, CH-domain 0.00000413
Further Details:      
 
Domain Number 7 Region: 4174-4215,4251-4371
Classification Level Classification E-value
Superfamily Plakin repeat 2.44e-41
Family Plakin repeat 0.0000144
Further Details:      
 
Domain Number 8 Region: 249-365
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 9 Region: 1142-1315
Classification Level Classification E-value
Superfamily Spectrin repeat 1.21e-16
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 10 Region: 600-702
Classification Level Classification E-value
Superfamily Spectrin repeat 5.18e-16
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 653-778,931-951
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000489
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 12 Region: 4121-4169
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000968
Family Plakin repeat 0.0085
Further Details:      
 
Domain Number 13 Region: 505-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000445
Family Spectrin repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014467   Gene: ENSGMOG00000013505   Transcript: ENSGMOT00000014841
Sequence length 4371
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4590:501765:562132:-1 gene:ENSGMOG00000013505 transcript:ENSGMOT00000014841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPPGPVFPALVVVGHILTLIAVWQWRQRKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQI
SDIQVNGQSDNMTAKEKLLLWSQRMVEGYQGLRCDNFTTCWRDGKLFXXXXXXXXPTLID
MNKVYRQSNQENLEQAFTVAERDLGVTRLLDPEDVDVPHPDEKSILTYVSSIYDVMPRVP
NVQEGIKANELELRWQEYYELVTVLLQWIRHHILVFEERKFPASYEEIEVLWRQFLKFKE
TELPAKEADKNRSKHVFNSFEGAVKSGHVKIPPGYHPFDVEKEWGRLHVAILERERLLRT
EFERLERLQRVVSKVQMESGVCEEQLNQVESLLQTDMRMLNAGKPAQHTAEMEADLEKAE
GMIRFLFNDVQLLKDGRHLQAEQMYRRVYRLHERLVNLRSEYNLRLKSGVTLTQIPMTQT
QITQTPTPQQAPVSVRPELDEVTLRYVQDLLGWVEENQVRVDQGEWGSDLPTVESQLGSH
RGLNHSVEEFRSKIERAKADEAQVSRVSKGAYRDYLAKLELQYGKLLNSSKSRLRNLDQL
HAFVLAATKELMWLNEKEEEEVTYDWSERNTNMTAKKDNYSGLMRELESREKKMNLVQAS
GDKLLRDGHPAKKTVEAFTAALQTQWSWILQLCCCLETHLKENGAYFQFFADVKEAEERM
KKIQETMKRKYTCDRTITVTRLEDLLQDAVDEREQLKEFGTHLEGLNRRAKNVVQLLPRN
PATPLKGKLPIQAVCDFKQLEITVHRGDECALLDNSQPHKWRVLNEKGSEAVVPSICFLV
PPTNKEAVHSVAGLDGNLQKMLTMWQTMHVDMKSLLSWQYLTRDINIINTWNITMXXXXX
XXXXXXXXXXXXXHYQAFLLDSQDSQMFGAEDRMQVEGGYNKANQRYNSLVTSVEQGEQE
ESFCKVYLTRIKDLRLRLEGCENRTITRLRQPVDKEPLKACALKTAEQMXXXXXXXXXXX
XXXXXXXXXXXXXXXPQEGSTAPLLRSELDFTLNKMEHVYSLSSVYLDKLKTIDVVIRNT
KDAEGTLKTYETRLRDVNKVPTDKKEVENYRSQLKKMRGEAEEDQGVFDRLQDELKKAGG
INERMTRVHSERDADLEHYRHLVGGLLERWQAVFVQMDLRQRELELLGRQMRSYHGSYEE
LMVWLREAKQRQEDIQALPIGDGKALGQQLKQEKILQEEIETNKDKIEDCQKYAKAYIDA
VKDYELQVVTYKAMQDPIASPLKKTKMESASDDIIQEYVTLRTRYSELMTLNSQYILFII
NTQRRLEDEEKATEKLKEEEKRKLAEMEAELEKQKQLADAHAKAVAKAQQEAQALKQQMN
DEVNRRQDVAVDAEKQKQNIQVELHQLKSLSEQEIKAKNQQVEEALLSRTKIEEEIHIIR
LQLETTIRQKTTAEGELGQLKNMANEAEKLRKAAQDEAERLRKQVAEETQKKKNAEEELK
RKSEAEKEASKQKQKAMDDLQKFKMQAEEAERRMKQAEEEKKRQVMLVEEVAQKSAATEL
QSKRMAFDEQATRLAESLKREQGTVLQLQGEAELLKKQQEEANNARENAEKELEMWRQKA
NEALRLRLQAEEEALKKSQAQEEAERQKVDAEKDAKKKAKAEEAALKQKDNAEKELEKQR
KLAEQTAQQKLSAEQECIRLKADSEHAEQQRTLLDNELQRLKNEVNSAQNQRKQLEDELA
KVRGEMDELLTLKNKALSESMSSTEKSKQLLETEVVKMKHLAEEAARLRSVAEEAKKQRQ
VAEEEAARQRAEAEKILKEKLAAINEATRLKTEAEIALKDKEAENERLKRKAEEEAYQRK
LLEDQASQHKQDIEEKIILLKTSSDSELVRQKQIVEETIHQRKVVEEEIYILKINFEKAS
KGKLDLEKELNKLKTIAEESQKSKLKAEEEADKMKKLASEEEKKRKEAEEKVKRISAAEQ
EAARQRKVAQDEVERLKAKAAEAKKQKEQADKEAEKQIVLAKEAAQKCTAAELNAQDVLN
QKKEDTLAQAKLKEEYENAKKLALAAEKAKKKAEKEAALLRQKAEEAEKQKKAAEAEAAK
QAEAQKDAERLRKEAEQEAAKRAEAEAAALEQKKQADAEMAKHKKHAEKTLKQKSVVEQE
LTKVKLRLDETDKQKSVLDEELQRLKAEVSDAVKQKALVEEELTRVKSQMEELLKLKLKI
EVENKRLMKKDKDGTQKFLAEEAEKMKSLAEEAAMLSVEAQETARLRQIAEADLAEQRAL
AEKMLKEKMQAIQEATKLKAQAVELQKQKNEAQENAQKLLEDKKLMQRRLDEETEGFQKS
LEAERKRQLDASAEAEKLKLRVRELSQAQAKAEEEAKKFKIQAETIRVQLQQKESLAQEK
VVVEKLEVQRLQSTKEADDLRKAITDLEKEREQLKREAEELQNKSKKMADAQREQIKQET
TSLQQSFLTEKALLLKREKGIEEEKNKLEKQFADEVAKAKALKDEQERQQKQMEEENKKL
QAAMDAALKKQKNAEDEMKKKQKEMEELEKRRLDQEKTLAEENKKLKEKLHELEVAPKPA
PSQTKVTTGQAGVPQEKIVAVTVDTTKKVFNGSDDLDSAKKDMDSHLAFDGIREKVPAGR
LHDIGVLTKKEFDKLKKGKVTAQELGKTDKVRSCLKGQNCLGAILTPSKQKMSVYQAMKE
KKIETNIAEMLLEAQAATGYIVDPLKNKVLSVDEAVKEELIGPELHNKMLSAERAATGFK
DPFTGVKISVFEAMKKGLIERDQAVKLMDAQLATGGIIDPVHSHRVPLQLAYTQGQFDEE
MNKKLTEPSEDCKLFIDPSTQEHLTYTQLLDKCSKDAETGLLVLPVTERAAQSESTYTDQ
ETQDLLSKANVTVPFGRFKGKTVTIWEVINSEYFTIEQRRELIRQYKTGKITVEKIIKIV
ITVMEDKEKKNENVFEGLRNQVSSSELLEAKVITKDVFNKLSNGEITVKEISESDSVKKA
LKGTHSIAGVMNESNKKKMPFYEAMKKELLSPDTAVNLLEAQAATGFIIDPVKNEKVTVD
EAVKSGLVGPELHEKLLSAERAVNGYKDPYTGKTVSLFEAMTKGLIKKDHGIRLLEAQIS
TGGVIDPVKSYRIPHEVACKRGYFNDEMSNSLNKNTDETKVFYDPNSQEEASYAQLLKKC
ITDKETGLPLLPLSSTSKKAIKSKEMTEAKTQEALDHTTMELDYGPFKGRKVTIWEIINS
EYITEVQRIELIRQYRTGYVTIERLITLVVTMVEEREEVAKENTCFKGIRSSVTASSLFD
ANIIDKATFDQLQEGKKQPKEVSDTDKVKKYLQGTDSIAGVLMEKSKEKLSLYQAMKNNT
LQQSTGLSLLEAQAATGFMIDAIKNQKFTVDDAVKEGVVGPELHERLLSAEKAVTGYKDP
YTGNKISLFQAMKKELVLREHAIPLLEAQLTTGGIIDPVSSHRVPTDVAIQRGCLNKQMA
KSFSEPSGDVKGFIDPNTNESVTYKQLLDKSTRDPDSGLCYLRLTKAEVPAPTETSYQYT
EEQAQAELANTEIDIPQEGGAGKSMTLWDVMGSNMLPEEERRRLLEQYRSGKISKDRMLI
IIIEIIEQREVLRTEQSMSCDVIRRRVTIEDLYNARIIDLQTYNLLKQEKLTPREVMETP
SVKKYLFGTGCIAGIMSDNPPKISIYQAMKRGLISPEIALNLLEAQAATGFMVDPVKDEL
LTVDEAVRKGLVGPEIHDKLLSAERAVTGYKDPYSGKVISLFQAVKKDLVPEEYALRLLE
AQIATGGLLDPEYYFHLPIDVAMQRGYINKETHDKITDPNGDVRGYTDPTTDEKQSYGQL
LKRCKPDKESGLRLLSLADRNLLFKGLRKQITIDELLRSQIIDQKMYDDLMEGLISVEEV
SRALKKFLEGTSCIAGVYVESSKDRLSIYQAMKKNMIRPGTAFELLEAQAATGYVIDPIK
NLKLNVQDAVKMGVVGQEFKDKLLSAERAVTGYKDPYSGKVISLFQAMKKGLILKDHGIR
LLEAQIATGGIIDPEQSHRLPVEAAYERGLFDQEMNEILTDPSDDTKGFFDPNTEENLTY
LQLMERCMIDPETGLALLLMKEKKRERKTSSKSSVRKRRVVIVDPETGKEMTVYEAYQKG
LIDQQTYQELAEQECEWEEITNTQSDGVVKSVIIDRRSGRQYDIDDAILKGLIDKSALDQ
YRAGSLSITEFADMLSGNMSGARSRSSSFGSTSSYSNSPVPVIKTPAVTWNDPTEETGPV
AGILDTDTLEKVSITEAIHRNLVDNITGQRLLEAQACTGGIIDPNTGVKYAVTDAMNEGL
VDKIMVDRINLAQKAYNGFEDPRTKTRMSAAQALKKGWLYYEAGQRFLEVQ
Download sequence
Identical sequences ENSGMOP00000014467 ENSGMOP00000014467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]