SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014534 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014534
Domain Number 1 Region: 1078-1218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-27
Family DBL homology domain (DH-domain) 0.00000502
Further Details:      
 
Domain Number 2 Region: 204-308
Classification Level Classification E-value
Superfamily EF-hand 3.02e-26
Family Eps15 homology domain (EH domain) 0.0045
Further Details:      
 
Domain Number 3 Region: 1011-1094
Classification Level Classification E-value
Superfamily SH3-domain 1.27e-24
Family SH3-domain 0.0000642
Further Details:      
 
Domain Number 4 Region: 10-106
Classification Level Classification E-value
Superfamily EF-hand 1.39e-24
Family Eps15 homology domain (EH domain) 0.0021
Further Details:      
 
Domain Number 5 Region: 675-758
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-19
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 6 Region: 777-852
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-17
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 7 Region: 875-932
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-17
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 8 Region: 942-1011
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000263
Family SH3-domain 0.0000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014534   Gene: ENSGMOG00000013569   Transcript: ENSGMOT00000014908
Sequence length 1218
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3347:105626:133848:-1 gene:ENSGMOG00000013569 transcript:ENSGMOT00000014908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLPPAKMNGSLGKWAISPEERNKHDQMFDTLLPAMGYITGEQARKFFLQSGLPGSTLAE
IWALADMNKDGKMDRLEFSIAMKLIKLKLQGTPLPSALPIIMKQPPVPAPTLNAAYGMAC
IPSNPTTTTGMSPLMSTMGNAAVLNSNMGVFQPYPVGSVATGLPLSAASSSPLGFASPSV
GVYRTSSLLDIGSSSSNSSSPALLSSKLPVPSDWSVPHASRLKYRQQFNSLDKQMTGYLT
GLQVRNAMATTMLTQTQLASIWNLADLDKDGKLKAEEFILAMHLVDMAKSGQSLPPTLPG
DLVPPTHRAAMNGSSSSLYAALTDDLAVEPPQKIKSNLTFEDKFKANLERGNAELEKRRQ
QLGGXXXXXXXXXXXXXXXCVRVSQAAQRVLERQRQEEFERRRRGELQIKKVQEQDDIIR
LKARKRSLEMELEAVGDKQRQISDRLRDAQGRRKLQRTEADLIGQRMDTRRDEINGLQRQ
LEEFQRKLSQMGPEQKRLTEKLQTMGHNNMPGAPLSTLKQNVTERSAACRQLRQQLETLE
RDTSVKLSEMDQYNHDVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSHLLRRIKEEKDRQWQEKLRRDEEERKRKIQEEREAKLREEEEKEVQAR
LVAAKEQAEREQQQQQPALTSFRALYPFTARNQDELSFDADDVIEVDETTEREAGWFYGS
KLGKMGWFPESYVERAADAPDTPVSPVSPGVAPRWLKPHLSKALEAAMAVGSKSAFTPTH
SPNPAPSETQGQVVGNLQAKALCSWTAKTDSHLNFSKDDVIRVLEQQDSWWLGELAGAQG
WFPKTYVTLLGDGRPAXXXXXXXXXXXXXXXXXXSPEYVALFTYESPQTGDLTFQEGDVL
LVSQREGEWWNGAIGDRIGLFPSNYVKPKESDXXXXXXXXXXXIGQVVTAYASSGLGQLS
LAPGQLVLILSRNVSGWWLGELQARGKKRQKGWFPATHVTVLGANSGKSTPAPLPVCQVI
AIYDYTAANGDEMSFSKGQLINVTNKNDPDWWKGELNGVTGLFPTNYIQVTTTECDPSQQ
WCANLSSLETMSPQERKRQGYIHELMETEEKYVEDLQIVLEXXXXXXXXSGRLTEAEMGM
MFVNWKELIACNTKLLKALRVRKKTGGDNMPVQVIGDILAAELAHLQPYIRFCSCQINGA
SLLQTRTDNQPEFKDFLK
Download sequence
Identical sequences ENSGMOP00000014534 ENSGMOP00000014534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]