SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014549 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014549
Domain Number 1 Region: 282-526
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.66e-56
Family Mitochondrial carrier 0.0006
Further Details:      
 
Domain Number 2 Region: 8-142
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000154
Family Calmodulin-like 0.056
Further Details:      
 
Domain Number 3 Region: 148-264
Classification Level Classification E-value
Superfamily EF-hand 0.000000613
Family Penta-EF-hand proteins 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014549   Gene: ENSGMOG00000013604   Transcript: ENSGMOT00000014923
Sequence length 579
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1366:229109:285893:-1 gene:ENSGMOG00000013604 transcript:ENSGMOT00000014923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLPKRADPTELKAVFEKYASIKNNDGSFMSPEDFVTQFLYARPGWWTRRKMGKNELISF
QEFLAFESVLCAPDALFMVAFLLFDKAGIGMTTFEDVKQVFSQTTIHQHIPFNWDCEFMR
LHFGSRHSRHLTYGEFTQFLLXXXGSTRGAFVQRDGGRSGAISALDFRDIMVTIRPHMLT
PFVENCLVAVAGGTTSHQVSFSYFNGFNSLLNNMELIRKVYSTLAGHRKNLEVTKEEFIV
AAQRFGQVTPMEVDILFQLADLSEPRQSGSDGSRPVLVQVAESAYRFTLGSVAGAVGATA
VYPIDLVKTRMQNQRTSGSLVEELMYKNSVDCFRKVVRYEGVFTGIGLVPQLLGVAPEKA
IKLTVNDFVRGKNRQKDGSVPLRAEILAGGCAGGSQVIFTNPVEIVKIRLQVAGEITTGP
RVSAVSVVRELGFLGLYKGGGACFLRDIPFSAIYFPCYAHLKTHFSQEDGTIGPAKMLLA
GALAGMPAASLVTPADVIKTRLQLSVARVFRSSPQFGVTLVTYELLQRRTHRKPSGSEPT
PKSRISLPAPSPDHIGGFRLAVATFAGVDSKFGLHLPRY
Download sequence
Identical sequences ENSGMOP00000014549 ENSGMOP00000014549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]