SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014683 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014683
Domain Number 1 Region: 74-251
Classification Level Classification E-value
Superfamily EF-hand 1.07e-48
Family Calmodulin-like 0.000000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014683   Gene: ENSGMOG00000013732   Transcript: ENSGMOT00000015059
Sequence length 255
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2124:148742:172583:-1 gene:ENSGMOG00000013732 transcript:ENSGMOT00000015059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGGKVTDGSLLGDANGLEPGPGRVKDSGKWQKPRFSRKALMKCCLVKWIIASTQPQDKE
SSDSDLELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPSGLVDEETFKSIYSQF
FPQGDATTYAHFLFNAFDKDRNGSIRFEDFVIGLSVLLRGSVTEKLNWAFNLYDINKDGY
ITKEEMLAIMKSIYDMMGRYTYPCVRDEAPSEHVDKFFQKMDRNRDGVVTIEEFIETCQK
DENIMNSMQLFENVI
Download sequence
Identical sequences ENSGMOP00000014683 ENSGMOP00000014683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]