SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014696 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014696
Domain Number 1 Region: 21-153
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 9.55e-45
Family N-terminal domain of cbl (N-cbl) 0.0000255
Further Details:      
 
Domain Number 2 Region: 239-311
Classification Level Classification E-value
Superfamily SH2 domain 9.57e-37
Family SH2 domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 155-238
Classification Level Classification E-value
Superfamily EF-hand 5.85e-32
Family EF-hand modules in multidomain proteins 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014696   Gene: ENSGMOG00000013744   Transcript: ENSGMOT00000015073
Sequence length 316
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4633:87185:92269:-1 gene:ENSGMOG00000013744 transcript:ENSGMOT00000015073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDGATASQSPEGGCGPCSGADRRTVDKTLKRLEKLHQLSSNPRLALKNSPPYLPDLVS
QTMRALTQVWEPHRVAGAAGPEPRGDEAEYLRVHARQLLDKTERALLLFKEGRDKMYEET
SNCRRNLTKLSLLFSHMLCELKALFPDGKFQGDSFRLTKTEAEEFWRGSFGKKCIVHWTA
LKEQQSVHLFEEGMESMALKSTVDLTCNDHVSVFEFDIFTRLFQPWRSLVRNWNQLAVTH
PGYMAFLTYDQVKTRLMHYLHRPGSYIFRLSCTKMGQWAIGHVTKEGAIIQTIPQNTPLY
QALVKGFKAGWASTNT
Download sequence
Identical sequences ENSGMOP00000014696 ENSGMOP00000014696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]