SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014727 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014727
Domain Number 1 Region: 106-322
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-49
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 458-526
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-18
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 313-452
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014727   Gene: ENSGMOG00000013769   Transcript: ENSGMOT00000015105
Sequence length 542
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3147:14002:20901:1 gene:ENSGMOG00000013769 transcript:ENSGMOT00000015105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGFLQPGFETAEGDGINPGMVINERSPQAKVESGHSLNIVKNIAFLYQEYRDTSKQQEID
LRRQRDGLTVKAIRRAVIKHESPPVGQLQLRNSINPMSLWQNLAIVQNSSLLNELSQKEI
IMQEAMFELVSSEASYYKSLEILETTFLHNPVLSNTLSNSDMHFLFSNIKEVVKASESFL
IDLENRIEQSILISDVCDIVHQHATEHFHVFNTYVVNQVYQEKTYRRILQENVAFRDAIT
SLEKLPCLRGLSFTSFLILPFQRIVRLKLLVQNILKKVEENSERETNAIKAHKELEQIVK
DCNEGVRKMSRTEELISIEKTLEFKCKSVPIISHSRWLLKKGEVQQMSGPKSTRTIRSRK
LYQPVYLFLFNNLLLITKRNSSGDKFQVLDSCTRAMLRTEDQEDQGQQLANIFNLKLLEN
QEERQVSYMLKTTSMSDKHRWICALTPHRRTRFMSTSAHQPDSPQVQCIQSYTAQEPDEL
SVEMADVLNILERTDDGWMMGERLHDSERGWFPTRVVEEIQNKEVRAQNRKEVLRIQQNK
ID
Download sequence
Identical sequences ENSGMOP00000014727 ENSGMOP00000014727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]