SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014734 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014734
Domain Number 1 Region: 6-462
Classification Level Classification E-value
Superfamily Sema domain 7.59e-143
Family Sema domain 0.00000000539
Further Details:      
 
Domain Number 2 Region: 465-509
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000759
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014734   Gene: ENSGMOG00000013766   Transcript: ENSGMOT00000015114
Sequence length 815
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1578:35052:55890:-1 gene:ENSGMOG00000013766 transcript:ENSGMOT00000015114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGCRRFQSPAAVDYGSLLLEAGGGRLYVGARGGAFSLDARDISANTTLAIQWETSQEKK
QQCLAKGRDNKTECFNHIRFLQRFNSTHLYMCGTYAFSPLCVYVEEEPFVMSSQPEEGKE
KCPYGPATGYTGLIVEQQMYSAARYEFRSFPDLRLNGPPLTLKTEDAPIRWLNDADFVGS
ALVRESVDSFEGDDDKIYFFFTEGSEEQTGGIAHGRVARVARICKGDRGGLLTLQKRWTT
FLKARLVCSQPEYDFHFNVLRSVFVLRGPPRDTVFYGIFGLDXXXRNVKASAVCRFSLSD
VQQAFQGPYMESQNSGSKWTEYTGKVPQPRPGTCMTDELRARDIALSTSLPDDVLDFVRR
HPLMARQVQPLDRHPLVYGRTTDYTHMAVDAVLGLDGQTYHVLFMGTDDGRLHRAVSVDD
HLHIIEELQLFEAPQPISSLVISPAQMSVYVGSPSGVVQLPLSTCHRYASCYDCVFARDP
YCGWNSSQCVPILSQADRSALIQDIQKGNRGCENTSRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXNMKAMYLSLITILGGLCVVLSVVLLYVGFCLR
AGSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSPEHELSSGLSATLPSVLRRMNGNSYVLLRQSEP
RRRSPGYAFNDELSKRLEKRKHTQLLQPRPDESSV
Download sequence
Identical sequences ENSGMOP00000014734 ENSGMOP00000014734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]