SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014792 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014792
Domain Number 1 Region: 337-597
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-68
Family Protein kinases, catalytic subunit 0.000000162
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily PH domain-like 7.28e-37
Family Pleckstrin-homology domain (PH domain) 0.0000948
Further Details:      
 
Domain Number 3 Region: 194-318,347-373
Classification Level Classification E-value
Superfamily SH2 domain 2.08e-24
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 4 Region: 163-202
Classification Level Classification E-value
Superfamily SH3-domain 0.0000683
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014792   Gene: ENSGMOG00000013813   Transcript: ENSGMOT00000015173
Sequence length 602
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3772:55664:66763:1 gene:ENSGMOG00000013813 transcript:ENSGMOT00000015173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMLILKGTMIKKSQQRRRTSPCNYKERLFILDTRSLSYLERRPGKKPILKGCIQLSNI
RCAEIVCSSIPIPCTNKYPFQVFHDNLHLYIFAPDNYCRQRWVRALKEEIRLNNLVVKYH
PNFWMYGRWQCCHQTEKLAAGCKEYSPEPNGTKVLPEGLLTTKERGVVALQDYTPQGHSD
LPLKADQEYTMIDSSHPEWWIIQDNMGQKGFVPCTYIAEKSGRNFDRFDWYNKDVTRLQA
EELLMTEGREGGFMVRDSRHAGFYTVSVFTKAAGSNGLKNPRVKHYQIWQEEATFYLAEK
HLFNNIPQVITYHKLNAAXXXXXXXXXXXXXXXXXXXXXXXXXXXRWEVDPEELVLGEEL
GSGQFGMVLEARWREKRVAVKMVKEEAMSEDEFIEEAQVLTKLSHCKLVKLYGVCSQRNP
PCLVLELMENGCLSDYLRARKGQLSPATMLVMCLDVSEAMAYLESLKIIHRDLAARNCLV
SKNNEVKVSDFGMARYVPDDLYTCSMGSKFSIKWSAPEVIKYSKFSSKSDIWSFGTTVYL
SYIAFXXXXXXXEVVEALATGLRLPRPRLAPDALYLLMEGCWRQKPGDRPSFAVLLHELA
SV
Download sequence
Identical sequences ENSGMOP00000014792 ENSGMOP00000014792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]