SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014809 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014809
Domain Number 1 Region: 387-580
Classification Level Classification E-value
Superfamily Fibronectin type III 2.58e-20
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 2 Region: 157-256
Classification Level Classification E-value
Superfamily Immunoglobulin 5.93e-18
Family I set domains 0.0018
Further Details:      
 
Domain Number 3 Region: 86-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000221
Family I set domains 0.031
Further Details:      
 
Domain Number 4 Region: 247-300,342-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000146
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 5-53
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000748
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014809   Gene: ENSGMOG00000013835   Transcript: ENSGMOT00000015190
Sequence length 691
Comment pep:novel genescaffold:gadMor1:GeneScaffold_892:35401:46682:1 gene:ENSGMOG00000013835 transcript:ENSGMOT00000015190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGEGDITWQKDGKEIDDEERVSKIDEVSSKLEIQNATLEDAGSYTCLCTFDNGDPDXXXX
XXXXXXGPSFGATQVYHEFLITRGMVPCLASGRPKVDVRWLRDEQVIHSQEGDRVTRLQD
NSLRIKNVRKDDAGTYTCQATIRGRPIKQDKQISVVVNAPPTVTLKEKIKKVMAGADKNI
SLLCLVDGQPTPNISWITLRRPVHSDWRYQFNSDQSELTICAVSRADYGEYICTARNKIG
ESTGTIELHVSEAPEVYVRAKEEKVSLGSNVSLPCNVTGHPFPQLYWIHKQSRNNMVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCLCQDSSGRVHVRDGVLTIAEVAPS
DGGLYSCMAVSASGNASRDVAVLRKIDLPGPPQEVSVTPRATSLVFSLKSQPISGGTPIS
SFVLQWRRGSAEKWEEIGVPVSDAVLSDPLAIPSLTPYTTYTVRLAAMNSVGLGQYSTTQ
EVRSQGIREPDRPVLSSDGMKIDGNALSVPVAQLVRGSSPLLHYTVRYREEKEGAGWKEE
QRPADTSVIALSDLAFGEDYRIEVKAVNANGSSIPAELSFSVSKQPGYSLPSHFAAGMTK
GGVVAIVMVIFLVLLLVVDATCCYTNNCGLLMFIATKVFGRKTPGHKTMEEGTNGDLNLK
GLDTPRGSIHQQQLEGKEEEITCDKAPLTKN
Download sequence
Identical sequences ENSGMOP00000014809 ENSGMOP00000014809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]