SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014846 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014846
Domain Number 1 Region: 159-262,304-577
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.79e-146
Family Myotubularin-like phosphatases 0.000000059
Further Details:      
 
Domain Number 2 Region: 1097-1163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.35e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 41-131
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000199
Family GRAM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014846   Gene: ENSGMOG00000013873   Transcript: ENSGMOT00000015228
Sequence length 1182
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4417:51480:80877:1 gene:ENSGMOG00000013873 transcript:ENSGMOT00000015228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEDGPPSLEYIKAKDLFPQKELVKEDDSLQVPFPALQGEGVEYLGRADEAVIAISNYRLH
IKFKDSVINVPLGLIESVECRDMFQLHIICKDSKVVRCHFSTFKQCQEWVKRLNRSVVHP
SRLEDLFALAYHAWCLGGSADDEDQHLHLCRPAGDHVRHRMEMEVRRMGFDTQNAWRVSD
INSNYKLCSSYPQKLLVPVWITDKELESVASFRSWKRIPVVVYRHQKNGAVIARCSQPEI
SWWGWRNTEDEYLVTSIAKACQMDGRGPRGAPGGRPRGEGPDSTDGDFDSSLTGGPGVED
SPAARQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVMFMGMANIHAIRNSFQALRA
VCSQIPDPGNWLSALESTRWLQHLSVMLKAATLVCSGLEREGRPVLVHCSDGWDRTPQIV
ALAKVLLDPFYRTIEGFQVLVETEWLDYGHKFGDRCGHQENADDVSEQCPVFLQWLDCVH
QLIKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLCNNAREREARNIFKRTCSVWSLLRTGN
KNFQNFLYIPSHEMVLQPVCHTRALQLWTAVYLPTTSPCTAVDDAMGLFLSPGAAGDELT
PRPLDRLPKTRSMDNLVSAFENGVPLTRTSSDPNLNKHCLEGRAAPXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDGLPVAMDAVQQRLRQMEACYK
QEVELLRQQVRRLQMKLESKQYGSPPSEPDLDYEDDITCLRESDNSNEEDSLSSQSEDRL
SEGSWDRVDQRDMEVTRWVPDHMASHCFNCDSEFWMAKRRHHCRNCGNVFCKDCCHLKLP
IPDQQLYDPVLVCSTCHDQLLECRHRDLRSQQLKKPIATASS
Download sequence
Identical sequences ENSGMOP00000014846 ENSGMOP00000014846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]