SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014980 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014980
Domain Number 1 Region: 697-1052
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.37e-92
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000693
Further Details:      
 
Domain Number 2 Region: 518-687
Classification Level Classification E-value
Superfamily ARM repeat 4.53e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000207
Further Details:      
 
Domain Number 3 Region: 111-277
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.38e-35
Family Ras-binding domain, RBD 0.0081
Further Details:      
 
Domain Number 4 Region: 314-481
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.87e-28
Family PLC-like (P variant) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014980   Gene: ENSGMOG00000013996   Transcript: ENSGMOT00000015366
Sequence length 1062
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1253:148851:178050:1 gene:ENSGMOG00000013996 transcript:ENSGMOT00000015366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAMTDILDMWSPLAGHATELVPVDFLLPTGIYIQLEVPSEATIQHIKLLLWKQAQTYP
LFPALGEMESHMFECVNQAAVHEELEDETRRLCDVRPFLPVLRLVTRNCGRAERLLDSKI
GVLIGKGLHELDALQAQEVKDFRAKMLRVSEARMQFYHAMTWSEWLQACFSPQSYSQEDY
LKITIHFDQSQDAASLRVSPAFTPTEVMEQGLKKWLTTHGPEDDSRQGPYVLRVSQRLEF
LCGDHPLIQYKYIKECIQAREPPHLTLVLTSTIRTMFEKEISAIGAVVSRKSSNPPVPLP
PKRRAPTTCVWDVSSQFKIILLKASKVNAEETAKVQVRAGLFHGTELLCKPAVSSESSGR
SEHAWSDGTLEFDIVASDLPRMTRLCFAVYAIMDKVKKQKSTKNTHSNKYQTIRKAGKVX
XXXXXXXXXXXXXXXQLKTGDVILHSWSSFPXXXXEMLNPIGTIQTNPYTENATELHVHF
QEYSSQPIVFPPFDKILEKAAEIAKANDLVPMGRGGKKFHIELKEIMERDPLSQLCENEK
DLIWTLRHDCHLKFPQSLPKLLLSVKWSKHEDMAQQLQALLQIWPRLSPRDALELLDFNY
PDQYVREYAVRCLREMSDEELSQYLLQLVQVLRYEPYYDCALTRFLLERAQANRKIGHFL
FWHLRSEIHMPAVSIQFALILEAYCRGSIPHIEVLKKQVEALSKLKSVNELIKLGTIKTA
RSKTKEAMLTKEAMMTCLRQSGYSETLSDLNSPLNPSIQLSGINVERCRYMDSKMKPLWI
VYHNKLLRGDSLGIIFKNGDDLRQDMLTLQILRLMDLLWKENSLDLRIVPYGCLATGDRA
GLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKEKNSGDALDRAIEEFTLSCAGY
CVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIKRERVPFILTHDFIHVI
QQGKTGNTEKFGSFRQYCEDAYLILRKNGNLFITLFALMLTAGLPELTSVKDIQYLKDSL
ALGKTDEEALKQFRQKFDEALRESWTTKVNWMAHNVAKDNRS
Download sequence
Identical sequences ENSGMOP00000014980 ENSGMOP00000014980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]