SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015038 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015038
Domain Number 1 Region: 129-222
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 823-902
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000559
Family DEATH domain, DD 0.00033
Further Details:      
 
Domain Number 3 Region: 218-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 277-323
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 5 Region: 23-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000617
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015038   Gene: ENSGMOG00000014037   Transcript: ENSGMOT00000015425
Sequence length 910
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3721:448773:512346:1 gene:ENSGMOG00000014037 transcript:ENSGMOT00000015425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDEFLGLRELPETFPSDPPEPLPVFLMEPEEAYIVKNKPVNLYCKATPATQIYFKCNSEW
VHQKEHTVEERVDENSGLVVREASIEITRQQVEELFGPEDFWCQCVAWSSAGTTKSRKAH
VRIAYLKKTFDQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNDDIIDPADDRNFYIT
IDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVHGGWSTWTEWTVCNSRCGRG
YQKRTRSCTNPAPLNGGAIXXXXXXXXXXXXXXXXXDGLWTEWSKWSTCGTECTHWRRRE
CAAPTPRNGGKDCEGVVLQSKNCTDGMCMQNSLFQKSSEAKDRNELAQPLAPSTDDVALY
AGVVIAVIMCLVISVVVALFIYRKNHRDFESDILDSSALNGGFQPVNIKTARTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIMSMNGNNGSQ
ASFLCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDVVVVGEENFTTPCYVQMDDEACHILTETLGTYCLVGQPLSAST
TKRLKLAIFGPVTCSAMEYHIRVYCLDDTQDSLKEVLQMEKQMGGKLLDEPKTLNFKDST
HNLRLSIHDIPHTMWKSKLLAKYQELSFQQVWAGSHRNLHCSFALERFSPATASLACKLC
VRQVEGEGQIFQLDTTLAEDTQNIDTSLLDPASNITTLVGPNAFRIPVSVRQKLCGSLDA
QTXXXXXXXXXXXXXXXXYLNYFATKSSPTGVILDLWEAQHFPDGNLHRLAQVLEEMGRH
DSLFPMATDH
Download sequence
Identical sequences ENSGMOP00000015038 ENSGMOP00000015038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]