SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015049 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015049
Domain Number 1 Region: 394-623
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.45e-32
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 2 Region: 1371-1522,1595-1620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-22
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 3 Region: 1046-1171,1239-1322
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.77e-20
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 203-274
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000157
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 5 Region: 2-81
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000165
Family Voltage-gated potassium channels 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015049
Domain Number - Region: 1632-1707
Classification Level Classification E-value
Superfamily EF-hand 0.0682
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015049   Gene: ENSGMOG00000013994   Transcript: ENSGMOT00000015436
Sequence length 2206
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1112:861393:922294:1 gene:ENSGMOG00000013994 transcript:ENSGMOT00000015436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFEYMILATIIANCIVLALEQHLPGEDKTPMSKRLEKTEPYFIGMFCLEAGIKIIALGFV
FHKGSYLRNGWNVMDFIVVLSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQTVDSSLSD
FPCGVRQCPDKYTCTEGWIGPNDGITQFDNILFALLTVFQCITMEGWTTVLYNTNDALGP
AWNCLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYR
AWIDRAEEVMLAEENKNSGTSALDVLKRATTIKRRGLDVPRGGPSDEDSYGDISSVGIPM
PRASIRSAKRGPTAYFRRKERLLRVSIRRMVKTHTFYWTVLSLVALNTMCVAIVHHNQPP
WLSVFLYYAEFLFLALFATEMFLKMYSLGPRLYFHSSFNRFDCSVIVGSIFEVLWGFFRP
GTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMNSMKSIISLIFLLFLFIVVFALLGM
QLFGGRFIFEDYTPTNFDTFPAAIMTVFQVTGEDWNEVMYNGIRSQGGVGSGMWSSIYFI
VLTLFGNYTLLNVFLAIAVDNLANAQELTKDEEEAEAAFNQKHALQKAKEVGAMSSLMSS
DGSRRRRPYLYRKRAIHRRERRRRMTMSVWEQRTSQLRRHRQMSSREVLHNSTGGEEAKD
GAAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRENTVPGLSEGQNQTHAPCPQNQ
GGQAELSPPVPPGDDSILLHPPPLLWSHLSTPPPPPPVNSKDSEGCPSEKGETEDSKPVS
TVPPNSMFIFKPNNPVRRACHYVVNLRYFETCILLVIAASSIALAAEDPVDTASGWNKAL
RYFDYVFTGVFTFEMIIKMINMGLILHDGSYFRDLWNILDFIVVIGALVSFALTNVLGNN
KGRDIKTIKSLRVLRVLRPLKTIKRLPKLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGYYIDYGKDKKEVKRRDWKRHEFHYDSVVWALLTLF
TVSTGEGWPQVLQHSVDVTEEDRGPSRGNRMEMSIFYVIYFVVFPFFFVNIFVALIIITF
QEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRLWHFVVSPSFEYTVLA
MIALNTIVLMMKYYSAPPAYDAVLKHLNTAFTVLFSVECILKIMAFGFLNYFRDTWNIFD
FITVLGSITEIVVMQXXDTFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSATGESWQEIML
SCLGGQRCELPASHTPALLTSDQEGGCGTDFAYFYFVSFIFFSSFLMLNLFVAVIMDNFE
YLTRDSSILGPHHLDEFVRIWGEYDRAACGRIHYTDMYQMLTNMSPPLGLGKKCPSKLAY
KRLVLMNMPVDEGMKVHFTSTLMALIRTALEVKIARGGEDRGQMDIDLQKEIAVIWPHVS
QKNLDLLVPIHKASDMTIGKIYAAMMIMDYYKQSKAKKLRQQLEDQKHAPMFQRMDASSL
PQDILCSAKTLPFLTHSAGSALSLSTRGGFVALSPISPQDMFLQRPLSHTLDKEEEEDYH
HPPVPEVVEYDRVMKQTAAQDPAAVIRSPGRTASIRASSMPRLAVADPQSGAAADSKLMK
RSFSTIGDQCVNGLWQEEHSLEKISPDCAYRPRQRSYRAGPRVTHKEAGAHERGRSKERR
HLLSPDVSRCNSEERSQDQSSERRRSRSPSEGRARDLQRQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGAGQPVSDTDEDDRC
Download sequence
Identical sequences ENSGMOP00000015049 ENSGMOP00000015049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]