SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015085 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015085
Domain Number 1 Region: 457-565
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.3e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0074
Further Details:      
 
Domain Number 2 Region: 612-708
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-17
Family Ypt/Rab-GAP domain of gyp1p 0.03
Further Details:      
 
Domain Number 3 Region: 775-902
Classification Level Classification E-value
Superfamily EF-hand 0.00000000099
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015085   Gene: ENSGMOG00000014099   Transcript: ENSGMOT00000015472
Sequence length 1079
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2271:1896:32174:1 gene:ENSGMOG00000014099 transcript:ENSGMOT00000015472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKPEEILLKNAFKLWVTENDNDYFVLQRRRGYGEGAGGLTGLLVGTLDTVMDSTSKVA
PFRILHLTPDSQIYWSIACGGTKEEIVKHWDWLQQNIMRTLAVFDSSDDITSFVQGKIRG
LIAEEGKSSMVQEEDPERFREALLRFHKWFELPAKEKLVTYYSCSYWRGRVPCQGWLYLS
TNFLCFYSYLLGAEVKLVISWDEIWRLEKTSNVILTESIHVQAHGENHYFSMFLHLHETF
LLMEQLADYSVKRLFDKESFNREPSLCDPLQITKRGLETHARSEQFRMFFRLPREENLLE
VHESFLWVPFSHFNALGKICLSESYLCFASQDGTQCHVIIPIREVVSVEKPDSSSRSLTV
CVRGKRALRFSEVRYYERLAGTIRSRCGIASSPQHSASTETLINHFEDNPDDVTLMVGQR
DSSKAVSTEALMTVFHPQDVENLDPKMLKEKMKEQSWNIHFTEYGRGTSMFFTKKTRDLI
VRGVPEALRGELWMLFSGAVNDMATHPGYYTELVEHSLGTSTLATDEIERDLHRSLPEHP
AFQSDTGISALRRVLTAYASRNPKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXALVDQAVFEELIRDHLPQLVEHMADLSFFSSVSLSWFLTLFVSVLPIESAV
NVVDCFFYDGVKAILQLGLAVLGANMEALISCHDDAEAVTILNKFFDSVTNKDSPLPPTV
QQASLSNSDRSSHATVDISELIRESYEKYGSIRSEDVESSRKRNKLFVIQTLEDTTKQNV
LRVVSQEVKFSASQLDDLYYLFKRQHFLSCYWMIDSPALMHHDPSQPYLDQYQLGFQQFS
LLFSLLEPWAVCSASHSLSLWVCRLIDHNQDGLVNFKEFCSALDIFYHGSFTDKLKFLFK
LHLPPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGKVDLQAYLKQWQ
DEILKKEETIKDLPRINQAQFIQLSKTMYNLFHGDPEEEELYRAVARVTSLLLRMEEVGR
RLQEPASRRPPGEVDWSFSFEQILASLLNEPKVVFFFERPVDADARLAHARAQQLRPRA
Download sequence
Identical sequences ENSGMOP00000015085 ENSGMOP00000015085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]