SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015125 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015125
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-19
Family Phosphotyrosine-binding domain (PTB) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015125   Gene: ENSGMOG00000014152   Transcript: ENSGMOT00000015514
Sequence length 169
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3469:181835:185395:1 gene:ENSGMOG00000014152 transcript:ENSGMOT00000015514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGSRSAVFSPWSSMEQTDPEVLDFSTKVQAQGVLWKRPFGRPSAKWSRRFFIIKDSFLL
YYAENEKKNFETSRCFNIHPKGVIPLGGCVVTASEDLGMPFAITVGLDGFTGAVVLAADS
SQEQNQWMELLLDSGKITWKNAQLGEAMIESLGAQGLQLAKEKQEYLGK
Download sequence
Identical sequences ENSGMOP00000015125 ENSGMOP00000015125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]