SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015202 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015202
Domain Number 1 Region: 263-391
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-27
Family Second domain of FERM 0.0029
Further Details:      
 
Domain Number 2 Region: 395-499
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-21
Family Third domain of FERM 0.011
Further Details:      
 
Domain Number 3 Region: 42-132
Classification Level Classification E-value
Superfamily PDZ domain-like 5.46e-18
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 176-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000723
Family Ubiquitin-related 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015202   Gene: ENSGMOG00000014146   Transcript: ENSGMOT00000015592
Sequence length 1485
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3762:115027:168501:-1 gene:ENSGMOG00000014146 transcript:ENSGMOT00000015592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAGRSRSPSRRTSRVEQVVGRWLRRSRDLGSRSHSLSRAGSSDQRSYSFRFTVQIQRS
SELNSHGLSLTSQTPILVQEVTAGGPADGRLVPGDQLVKINNVAAEDLTPEQAAEIIREC
QDIVTMTVLRTMVGPKSSFITPEKRAKLRSNPVKVHFAEEVEVNGNSQGNTLLFLPNVLK
VYLENGQTKAFKFEPNTTVKDIVMTLKEKLSLCRIEPFCLVLEQQHSVTKLLLLHEEERI
QQVVQKKESHDYRCLFRVCYMPKDPRDLLLEDPTAFEYLYFQGVNDVLQERFAVEMRCNT
ALRLAALHIQERLASCGQSPKTTLKTITKTWGIENFVSSTLLRNMREKDLRKAVGYHMKK
SQSQQDPKQKGLSFNQARINYLEELSELKSFMGKSFSATMLLQDRESTVSLLVGARYGVS
QVVNHKLSIMTTLTEFSSISRIELLPESERISLVKIYLQDIKKPITLLLESVAAKDMSCL
IAGYCKVFANPDIQVFPWPEKPKKHRVSAEEGYVSRRASDSDSSSDMDADPLIHLVSHDN
KPRPRIRSSSDPERPKRKERERPRPPGAKAKAEKPWRPEGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEPVHILQPPPGFGDSSSEEEFFDAWDRFSSPEEPSAGGVPGAE
MKPNLVRTLSLSDIRAIVDDKEDRDGGLRRRSRKRRSFMETTFTSMVTFPETQRGLPSQD
GDTHLSGDPEAPEQTQNICPTVASMTHAEGEPALLESKPIPSGSPDSDRELLTASRRKKQ
EMEMEPDAMESKSVTDLVKTSPPSITVVRCRVEPDGKESADRIEIIEEVSVRKETSGTRR
SGERESVSGAETLKEKRTSQSDNVFADDFLTQLPPPPSFAQPLPPNCFSPPLPVVIIPPR
IPSSHLHNKWAMIRKCTFELPKLKFLNREQCYNTVTKNDGTSSISNSDTTSDDVIDVVES
DNVFVVEDEEDDEDNDDSEEDDDITESIESDDSDVTLTGSEVETEVDGELGSPLVPETTS
AESVAVSNALCHVQSEPRTAPHVIEPCSDTPGPIVKPPTSGVPSDTEARTPGPVKEAPES
SMKSASPQRNCSSVLSSGCESAVEGLQTPLEACGCTAVYTNCFSSGDNFDDELTVYEFSC
RSQGSSRAGSTSEVGLPLITAAGPLSPLLSPLSDSQDSVSSQSHKETISSIRQHCYPANP
AGFQPLRSDVDQLIAILEGGAVRAVGGHGGRHARETCPAHFTENKHVLHTEARRLMAGCQ
KAAALGQNPEETLVALADSFRHLVELAGACLWFSGCDRCDRRNGEAVAGLADVARSFRDF
CLAAERACSKRSCQDLSAKLLAKQCTALTASVFCLTQLFRTLTAL
Download sequence
Identical sequences ENSGMOP00000015202 ENSGMOP00000015202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]