SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015210 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015210
Domain Number 1 Region: 693-988
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-72
Family Protein kinases, catalytic subunit 0.00000841
Further Details:      
 
Domain Number 2 Region: 1681-1949
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-58
Family Protein kinases, catalytic subunit 0.0000595
Further Details:      
 
Domain Number 3 Region: 184-304
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 310-407
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 588-682
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-20
Family I set domains 0.0075
Further Details:      
 
Domain Number 6 Region: 2-164
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-18
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 7 Region: 398-492
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000709
Family I set domains 0.027
Further Details:      
 
Domain Number 8 Region: 1568-1667
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000292
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015210   Gene: ENSGMOG00000014158   Transcript: ENSGMOT00000015600
Sequence length 1991
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2726:153257:182417:1 gene:ENSGMOG00000014158 transcript:ENSGMOT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLIQGLVDGEEEFVKEMKDFASHHLETGPHVLPSVLTQRETVFRNISDIILLHERSVLPR
LSDCATDDDVAMHLLRQAEDFEKYVHYMVGQTQAEASVTEKAVQQYLNDPSEPGNPETTA
MEVLTFLQRPMERIQTYQALLKELIRNKAQSGQACCVLEDAFSMRLPGRSEKLRLVSLIE
NYPAPLSALGEPVRQGVLTVWEESPEMKTASRGQQRQVFLFKDCVILCKLKRGPGANADV
YGFKNKMKLNDLKVKDSPGGGGDERSWVLGHEHRGSVRTYTLQGRSTLVKLSWLRDIREL
QQTSSSPASPPVFEEQLSDVTTQPGQTIQLACRVTGSPAPVVSWLKDGLHLDVDLRHILT
ARRSGAHSLVLDGLAPGDGGQYLCYALSPVGSASTLARVTVEGPPRFLSRLESMCLMEGE
DLQFICSTLSTPLPRVXXXXXXXXXXXXXXXXXXXXXXXGILTLTVVSPTEADVGLYECE
LSNPMGCAKCKAGLCPAYVPSIDSEIVEPQDLSPKDADSEGWSAVLVKNPKSIVRSLFGP
GSSEDPEVGEATPPPTETPPREPLYYPEGEEEELFISEPMQEIQDAPPFVQVPPESLCVE
PGQSAVFTAIITGRPAPHIQWYKEDEEELSANDNVEMRQQGARCSVTVVCPEGEDSGMYT
CLAYNDSGHTSCQAELIVEEGPLEVEEREVELGRRRKLFSVYDIHEEVGRGAFGVVKRVV
HRRTGEGFAAKFLPLRNSTRTRAFQERDLLSRLAHPRVACLLDFFCTRRTLVLVTEVCCP
YGLLDHLLLKASVTEREVQSYLQQILEGVAHIHSMNILHLDLKPDNILMVYPPRDEVKIC
DFGFSQEMDASRHQYSKFGTPEFVAPEIVHQEPVTGATDVWSLGVIAFLCLTCRCPFAGE
TDRATLLRVGEGTLSWETPDLTARTPEAQDFLRLVLQPEPERRPTATECLSHEWFLDEHA
VEDTDDINTRSLKVFISRRKWQRSLTCIGSVLTLRPLPELLGAPLRDTAATVPREPRDHS
SSSPSSGSSSEYDEADSWDFFQHASPTEEEEDDDEGYDPLAKRARIPALHRAALHDEEEE
EETLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTDDEGGRRKLLAPPVAGRTSRRRGSVAPVQGSLFLGGALVGSRLQAGAGSHSPLAGP
LVRVHGDSESPSGPGPCEEAGPVLSAARFRPGQRYGAPCSSGSPRDAEPKSAAPRPPPRT
RTRSHQDLAASSSGSLHRAGVPSGVQPSPSPSLTSLQSPERPPQAKDKMGSQGLQRHASA
PALEIKIPPGRSPKLGLMKIFRRQSWTGHSYAPLETPGMGPTLGEIMAPDTPTMTLRKKM
RASASSLTKLFRSSSKEDLTKGVKGPIVKGSPIPPKRGSPSGSESPQNRVSRLMSSFKIP
AFKKTKEPPPRRSRPDVVQLDGGGVLLVWKQVQTPSPALYCVQYCSDWRALSEGVAENVL
VVKDLPRGASYVFRVGVVTQQGAGSFSDPSLPVVMATHPEEVQLPLIQTDSPETRAVGGA
QPSHKTYSFLSEINRGRFSVIIQCRDAQSGRVCAAKLTPYGPEQRQGVLREYLILRRLHH
RHLVQLHTAYITPAYLLLVLELCPGRELLPSLAQRDLYSEKHVAELLVQILGAVDYLHGR
WVVHLDLKSDNVLVNEQNQLKIVDLGSAQPFTPGQPVHIEHYQGLAENKVYIVLPKAPEI
LEGNGVGPETDIWAIGVLAFIMFSADAPFHSELGWEQDRNIRKGKIQFSRCYPGLSEGAI
NFMKTSLNPKAWGRPTAAECLQSPWVRAPRGPAQQGGSLVSFSTDKLKAYLRERQAKRDQ
VQTKLRGPFFK
Download sequence
Identical sequences ENSGMOP00000015210 ENSGMOP00000015210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]