SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015211 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015211
Domain Number 1 Region: 471-705
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-35
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1077-1317
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-33
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 784-939,979-1007
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.14e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 49-194,264-336
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-24
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015211
Domain Number - Region: 1324-1473
Classification Level Classification E-value
Superfamily EF-hand 0.00126
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015211   Gene: ENSGMOG00000014162   Transcript: ENSGMOT00000015601
Sequence length 1994
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2599:95384:176583:-1 gene:ENSGMOG00000014162 transcript:ENSGMOT00000015601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLSQRKRQQYAKSKKQGGSTNSRPPRALFCLTLNNPVRRACISLVEWKPFDIFILLSIF
ANCVALAIYIPFPGDDSNSTNQELETVEYAFLIIFTIETFLKIVAYGLVMHQNSYVRNGW
NMLDFVIVVVGLFSVVLELITKDADSGSQTGGKPGGFDVKALRAFRVLRPLRLVSGVPXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQALAEEEPTPC
TLTGHGRQCLNGSECRDDWHGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMG
FELPWLYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGY
LDWITQAEDIDPENDEDCDEDGKRNRVTLADLTEKKKGKFGWFTQSTETQVTASIPTSET
ESVNTENPNGEEGRSKCCGQICLNISKSRGSRQWRRWNRFCRRKCRAAVKSVTFYWLVIV
LVFLNTLTISSEHYNQPDWLTEVQDVANKVLLAMFTLEMLVKMYSLGLQAYFVSLFNRFD
CFVVCGGIVETILVELAVMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIA
SLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFDNFPQALLTVFQILTGEDWNQVM
YDGIMAYGGPASSGMVVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEEEA
KKRKNNACEEEEEDLPEIPPGPRPLRMSELTMKEKTPPIPEGSAFFIFSSTNPFRVLCHK
LINHQIFTNLILVFIMLSSVSLAAEDPIRNFSRRNFILGYFDYAFTAIFTVEILLKMTAF
GAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGL
KHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDDAKSSPDECKGNYIQ
YTNGDTALPMLRERKWNNSDFNFDNVLMAMMALFTVSTFEGWPSLLYKAIDSNRENMGPI
YNYRVFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEY
VMFVLIILNTLCLAIQHYKQSDMFSSAMDILNMVFTGVFTVEMILKLIAFKPRHYFADAW
NTFDALIVVGSVVDIAITEINNQDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIK
SFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGTHINRNNNFQTFPQAVLMLFRCATG
EAWQEIMLACMPSENCDSESGEKSCGSGFAIIYFISFYMLCAFLIINLFVAVIMDNFDYL
TRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKR
LVAMNMPLNSDGTVMFNATLFALVRTALKIKTEAGNLDLANEELRAVIKKIWKRTSMKLL
DQVVPAAGDDEITVGKFYATFLIQDYFRKFKRRKEQGLVGRHPWDGLNTTMALQAGLRTL
HDIGPEIRRAISCDLQEEGLVEANGEEEEEIYRRNGGLFGNHVCHANGDQRGSAHLSNVT
QRPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRYYEAYVGGGA
YPAIRREEPGGGTSDEDWGSGEYYSGEEFNEDDIMFTRDRSSLKTDYHDAGGTRRSPRGY
YDDDQQPIFQDGCRSPKRRFLSSPQPSGRSTFSFECLRRQGSDEDPPPLSPSCTALPLHL
MQQQVMAVAGFDTRRLRRLSPTQSLRSWATPPASPIGRDGSPSYTPLIQVDWRSPGSIGS
IPGSLRRSSWYTDARDGPPSRAYSPSLLRLPTESHAHFMQKRGSANSLVEAVLISEGLGR
YARDPKFVTAAKHEIADACAMTIDEMESAACHLLNGTMGNGLRELSLRDYSDEEPEECRS
EEDLTDEMICITTL
Download sequence
Identical sequences ENSGMOP00000015211 ENSGMOP00000015211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]