SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015274 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015274
Domain Number 1 Region: 213-268
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-20
Family SH3-domain 0.00068
Further Details:      
 
Domain Number 2 Region: 50-107
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0072
Further Details:      
 
Domain Number 3 Region: 272-327
Classification Level Classification E-value
Superfamily SH3-domain 0.0000747
Family SH3-domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015274   Gene: ENSGMOG00000014290   Transcript: ENSGMOT00000015665
Sequence length 328
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2599:195451:200705:-1 gene:ENSGMOG00000014290 transcript:ENSGMOT00000015665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDDKNSVDIHDNPPAPDNFVREEGDTVYFIYDEEVEVEEKEPEPPPEPVVMINDKPHKFK
DHYCKKPKFCDACARMIVLNNKFALRCKNCKTNIHHSCQSYVEFQKCFGKIPPGFRRAYS
SPLYSSDQPDPSNTNRNDPVFDTLRVGVIMANKERKKNDNDKKNMMMMMEEEEEDGGQPK
ENEEGGEGKPEDQKKEKGGDKADEKSKGAFSQSHYYLALYRFKAIEKDDLDFHPGDRIIV
LDDSNEEWWRGKMGEKTGYFPTNYLIKVRAAERVYKVTRSFVGNREMGQITLKKDQIVVK
KGEEKGGYLKVSTGRKLGFFPADLLEEI
Download sequence
Identical sequences ENSGMOP00000015274 ENSGMOP00000015274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]