SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015396 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015396
Domain Number 1 Region: 45-792
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.76e-255
Family Motor proteins 0.000000000213
Further Details:      
 
Domain Number 2 Region: 2037-2127
Classification Level Classification E-value
Superfamily PH domain-like 3.24e-21
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 3 Region: 1946-2036
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-18
Family Second domain of FERM 0.003
Further Details:      
 
Domain Number 4 Region: 1222-1278
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000637
Family First domain of FERM 0.042
Further Details:      
 
Domain Number 5 Region: 1825-1884
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000372
Family First domain of FERM 0.069
Further Details:      
 
Domain Number 6 Region: 1538-1607
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000956
Family SH3-domain 0.0034
Further Details:      
 
Domain Number 7 Region: 1354-1411
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000209
Family Second domain of FERM 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015396
Domain Number - Region: 795-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000127
Family Motor proteins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015396   Gene: ENSGMOG00000014332   Transcript: ENSGMOT00000015791
Sequence length 2142
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2571:39655:81429:-1 gene:ENSGMOG00000014332 transcript:ENSGMOT00000015791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYFSVSQGDYVWLDLKTGREFVVPIGAVVKLCDSGQIQVLDDEGSEHWISPQNATNIKPM
HPTSIHGVEDMIRLGDLNEAGILRNLLIRYREKLIYTYTGSILVAVNPYQVLPIYTADQI
RLYTNKKIGEMPPHIFAIADNCYFNMQRNNRDQCCIISSGESGAGKTESTKLILQFLAAI
SGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLE
KSRVCRQAHDERNYHIFYCMLKGMTQDEKKKLALGKATDYTYLTIGGCTTCDGRDDMKEY
SNIRSAMKVLMFTDTENTEISKLLAAILHMGNLRYEARTYDNLDACEVVRSPHLTTASTL
LEVDGKDLMNCLTSRTLITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVGKINAAI
YKPPPNPSKAVRRSIGLLDIFGFENFTINXXXXXXXXXXXXXXXXXXXKLEQEEYNLENI
NWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDNTMLNKLNSQHRLNTYYIPPK
NSYETQFGVQHFAGVVYYETKAGFLEKNRDTLYGDIIQLVHSSKNKFIKQIFQADVAMGA
ETRKRSPTLSSQFKRSLELLMRTLGVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGM
METIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGRDDDWQM
GKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKLRKSAMMIQKTWRGY
QARKNYGAMRAGFSRLQALVRSRKLYTMYHVARQRVTGFQGCCRGFLVRRAFRHRLWAVI
TLQAYTRGMIARRLVARLKGEYRRRLEAEKMRLAEETKLRNQMSAKKAKAEAERMHQERM
AVLAKEDAERARHEPVNDSDMVDKMFGFLGTTNSFPGQEGQAPSGFEDLERNRRELMEED
LDEALPLPEDEEEDLSEYKFAKYSATYFQGPSSHTYVRRPLKQPLLFHDDEGDQLAALAV
WITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKTYKRELQALTPPDETHKKNS
VRHKMVSLTLKKKSKITVEVTKRLHDGEYGNSMLEDRPTSNLEKLHFIIGNGILRPALRC
THKLMCKQLSQNPSKSSHARGWILISLCVGCFAPSDKFLKYLRNFISGGPPGYAPYCEER
LRRTFVNGSRTQPPSWLELQATKSKKPVMLPVTFMDGTTKTLLTDSATTAQELCSALSDK
INLKDRFGFSLYIALFDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDLAELASQQYYVDYGSEILHERLLS
LIPSYIPDREVSTARTVEKWAQLIMAAHKKAIYTQKRFDAQKVKEEVVDFSRHKWPLLFS
RFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPDVMAVSSSKGGKLQGQS
FTLATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKFVVALQDNPNPAGEESTFLSFLK
GDLILLDQDTGEQVLNSGWAHGINERTNQRGDFPADCVYVLPTMTKPQPDIVALVTMTPD
QRQESVRVSHMALPDSSERMKPYTLEEFSYDYFXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXMMKYMGDYPSKRTRSVNELTDQIFEGALKAEPL
KDEIYSQIIKQLTDNHVKYSEEKGWELLWLCTGLFPPSNVLLLHVQRFLQSKKHHPLAGD
CMQRLQKALRSGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCL
NISTRLLLKSSEGFSLFVKISDKVRNSACIPARGLWRDAPQWXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXELPKYLRGYHKCSREEVFQLGALIYRVKFEDDKSHFP
AIPKMLREIVPQDLIRQMSPDDWKRSVVSYFNKQSGKSRDEAKLMFLKLIYKWPTFGSAF
FEVKQTTEPNFPEILLIAINKHGVSLIDPKTKDILITHPFTKISNWSSGNTYFHITIGNL
VRGSKLLCETSLGYKMDDLLTSYISQMLTTMSKQRSGRSHNK
Download sequence
Identical sequences ENSGMOP00000015396 ENSGMOP00000015396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]