SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015417 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015417
Domain Number 1 Region: 318-539
Classification Level Classification E-value
Superfamily Caspase-like 4.64e-34
Family Caspase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 214-293
Classification Level Classification E-value
Superfamily Immunoglobulin 3.74e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 8-108
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000141
Family DEATH domain, DD 0.01
Further Details:      
 
Domain Number 4 Region: 106-183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000012
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015417   Gene: ENSGMOG00000014328   Transcript: ENSGMOT00000015812
Sequence length 750
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3000:40862:47265:-1 gene:ENSGMOG00000014328 transcript:ENSGMOT00000015812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDWNRNLGTLSEDALSRLGEILDNCTRGWRQLANIANEHPQFRCSENELTSCSVQVLSP
TGSPARYLLARLADRSCSLAFLLSCLKKMDNQHAVQYLTATAVMENIHITVQPQSQQALE
GGRVVLACRAAGPAGLSYQWFRGKEQILGGSGSAADLVLSPLGPVHQGHYICRVNHGDTC
IFSQWAHIQFSRSEFSSPGCSSTLFPGSKSGLCITRQPQSQTVTEGDSLFLECLVEANPP
AQFHWHHNMNAMQQQKSSVLRIPAVTTTDRGQYSCKVYNLFHEIWSNPVQIHIGPSSLSD
GSWTEVDTGRIFLSSSSFRTATDKVALLIGNMNYSHHIQLSAPMADVHELANLLRQLDFK
VVSLLDLNWQEMNSAVTEFLLLLDKGVYGLLYFAGHGYENYGNSFMVPIDAPASYTSDHC
LCVQSVLQRMQERETGLNVFLLDMCRKRNPNDDVIPHSGPLKVTANIVFGYATCVDAEAY
EVKEDNLNNGIFISFLKQRVCEDEKVTVMLDRVAEDMGRCELMRGIQALELRSNLSERRA
LTDLIQSTESPTDHSARNLQWAIAHVLPKSRTLHFECGVQVQIGFAAEFSNIMIIYTRIL
EKPKEIMSCSAELIDFPEEGVDLDLKKSNQGSVLEAGSLLPIMEILPPAQSPGLYTRLKS
LQRLKKELTFTVCLHYRYSNMDDEEVQDMRRVTVGKPLVSKLNLHEPRKPRSSSSDRPSV
NAPETSMYAEDLGQDFPASETSSIGSALTT
Download sequence
Identical sequences ENSGMOP00000015417 ENSGMOP00000015417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]