SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015423 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015423
Domain Number 1 Region: 119-261
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-39
Family Third domain of FERM 0.0000137
Further Details:      
 
Domain Number 2 Region: 16-120
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-38
Family Second domain of FERM 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015423   Gene: ENSGMOG00000014418   Transcript: ENSGMOT00000015817
Sequence length 269
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1464:111825:118522:1 gene:ENSGMOG00000014418 transcript:ENSGMOT00000015817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSWRLGFSVKFYPADPSILIEDITRYYLCLQLRDDILSGRLPCSFVTHALLGSYTVQAE
LGDYEADDHGPDYVSDFRFAPNQTRELEERVMELHHNYRGMSPAEAEMNFLENAKKLSMY
GVDLHHAKDSEGIDIMLGVSANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEY
EQFESTIGFKLPHHRASKRLWKVCIENHTFFRLVSPEPPPKGFLVIGSKFRYSGRTQAQT
RQASALIDRPAPQFDRSVSKRYQLPRGLD
Download sequence
Identical sequences ENSGMOP00000015423 ENSGMOP00000015423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]