SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015511 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015511
Domain Number 1 Region: 7-209
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-34
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 243-434
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.83e-22
Family BAR domain 0.023
Further Details:      
 
Domain Number 3 Region: 589-652
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000446
Family SH3-domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015511
Domain Number - Region: 485-548
Classification Level Classification E-value
Superfamily SH3-domain 0.000294
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015511   Gene: ENSGMOG00000014487   Transcript: ENSGMOT00000015906
Sequence length 654
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3387:282:25619:1 gene:ENSGMOG00000014487 transcript:ENSGMOT00000015906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEAAAREKAAQRQLLAIEELVHTERNYLRLLQLASVTIRNNLSKMEPPLVGLSSMFLHVE
EVMEVSGRLLSLLDQKLVKPGDPQYLHILCDSFLSMSPDIEESYKEFLANYTLVTTLENT
YKQKEALXXXXXXXXXXXXPEVNATSLSFFLVMPVQRIARYPLLLQTIKKHTETAHPAYK
RLEEAAHTAIALNCRINEYKRFREVADKYKKTETLSIKDKINRLNSHSIAKKTARLSQYI
KHETGMASKLVDEEFDALEMFFYVLEKGILELHDNVGSYLCHLQEFLACRPEECDLDLHG
NKPAICYKEIQTALRQWILPTFEKRMRSLIYKPLCSLRDLLAGPRNLIRKRLDKLLDYEV
LEARPSLNYEEQAIASTYRTINTLLLNELPQFNGLALGMMWSVLGTFSSLHLDLTSDMEQ
LFQGFAQQLPHSSLEPGAFWEWVEHAVLEGARNLESVCCNVEETLSAPISQPLSPSSQRR
LALLTQKHGSEKIFQVSGAVVGGRDLDLSLGRGELVAVVSQKDSRGDKRRWLVDAGGYAP
SAKLIRYRQAVEDPPPSPHLTLPVVPAGQRRHSYSPETRSLTLPAMSRPCFQPPLQVFVS
YDFTASGAREFSVRAGEAVRVLESHDKGGNPDWSLVEAAQGRRGYVPSNYLVVM
Download sequence
Identical sequences ENSGMOP00000015511 ENSGMOP00000015511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]