SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015572 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015572
Domain Number 1 Region: 41-545
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 8.59e-176
Family Myeloperoxidase-like 0.000000000000655
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015572   Gene: ENSGMOG00000014548   Transcript: ENSGMOT00000015968
Sequence length 554
Comment pep:novel scaffold:gadMor1:scaffold06560:18363:34321:-1 gene:ENSGMOG00000014548 transcript:ENSGMOT00000015968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPCCNYPCENSGTCVRFGTERFECDCTRTGFHGDNCTVPEFWTRIHHLLKPSPDTVHYLL
THFHWLWDVINSSFLRNILMRVVLTVRSNFIPSPPTFNSKYGYLSWESYYNLSYYTRILP
PVPEDCPMPMGTKGKAVLPDPRDLVTRFLIRKKFRPDPQGANLMFAFFAQHFTHQFFKTH
TGWAFTRALSHGVDAGHIYGDNLERQLQLRLHQDGKLRYQGEMFPPTTQEVPVAMSYPSS
VPPSQRLALGQEVFGLLPGLTLYSTLWLREHNRVCDVLKEVHPTWGDEQLFQTTRLIIIG
ETIRIVIEEYVQQLSGYLLKLKFDPTLIFNDQFQYSNRISLEFNHLYHWHPLMPDSFLVD
GQDITYPDFLFNTSVLLHFGVEKLVDSFARQQAGQIGGGWNVHARLQEVVELVIKESRAL
RVQPFNEYRKKFELKPYASFYEFTDDKEMARQLEELYGDIDALEFYPGLLLERTRDSAIF
GESMVEMGAPFSLKGLLGNPICSPVYWKPSTFGGAAGFDIVNSATLERLVCLNSRWCPYV
SFHVPRSEEDHRPR
Download sequence
Identical sequences ENSGMOP00000015572 ENSGMOP00000015572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]