SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015643 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015643
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.99e-32
Family G proteins 0.0034
Further Details:      
 
Domain Number 2 Region: 415-586
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.98e-24
Family G proteins 0.016
Further Details:      
 
Domain Number 3 Region: 168-268,310-368
Classification Level Classification E-value
Superfamily EF-hand 2.63e-22
Family Parvalbumin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015643   Gene: ENSGMOG00000014599   Transcript: ENSGMOT00000016042
Sequence length 660
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4486:27286:52889:-1 gene:ENSGMOG00000014599 transcript:ENSGMOT00000016042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKDVRILLVGEPKVGKTSLIMSLVSEEFPDEVPLRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLYQEISKANVICIVYSVNNKKSIEKVTSHWIPLINDRTDKDSRVPLILVGNKS
DLVEHSSMETILPIMNQYQDIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPSCVKALTRIFKVSDLDNDGILNDNELNFFQRTCFNTPLAPQALEDVKNVVRRNMTDG
VQDNGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLELTQEYLFPLIKIPPDCTTE
LNHNAYLFLQSVFDKHDKDRDCALSPEEVKDLFKVFPYMPWGPDVNNTVCTNDKGWITYQ
GYLSQWTLTTYLDVQRSLEYLGYLGYSIIYEQESQAAAMTVTRNKRIDLQKKQTQRSVFR
CNVVGSQGSGKSGFLQAFLGRSLQRQRTIREDHKSLYAISTTYVYGQEKYLLLHELMPEF
DFLSEADLSCDVVCLVYDVNNPQSFEYCAKVYKKHFMDSKTPCMLIAAKSDLHEIRQHYS
LTPLEFCRRHKLHPPQPFTCNTSDVPIKDLYTKLTTMAMYPHARLRCTCASKRCAYCLCQ
KLLTLGLLRSVKAQLRRVALHRHLAQVDSKNSTFWLRASLGATVFAVLGFAMYRALLKQR
Download sequence
Identical sequences ENSGMOP00000015643 ENSGMOP00000015643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]