SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015671 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015671
Domain Number 1 Region: 177-264,295-417
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.00000000000124
Family Diacylglycerol kinase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015671   Gene: ENSGMOG00000014633   Transcript: ENSGMOT00000016072
Sequence length 419
Comment pep:novel genescaffold:gadMor1:GeneScaffold_562:349:38783:-1 gene:ENSGMOG00000014633 transcript:ENSGMOT00000016072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLRDVFAVKVKRRRAAGQQTGGAVLGLCLFCSHRTGNTLQEQHLLNTSLSLCHTWVTQL
TQLLTVLPPQLKVFINPGSHKKQSVLIYREHIAPLFRMADIHTDITXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTDIISCS
VHGVRHPITAALHIILGHLQQVDMCSFSSLGRLLTFGFSAMFGFGGRSLALAERNRWMPP
SQRRDYALAKTVASLRPEECHLSFLPVNQKHXXXXXXXXXXXXXXXXXXXXXXXXWETKP
GVYLSISIMSIPGLSPHAPRGLAPNTRLTNGSAELITVGNASRSEFIRHLKRYSCPDEQS
SLSFVETRSVTAVKLRPYGLVGCPGKGEKEEATSGDDSEGSFPWNIDGELVEMAHEVVV
Download sequence
Identical sequences ENSGMOP00000015671 ENSGMOP00000015671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]