SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015768 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015768
Domain Number 1 Region: 36-621
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.54e-192
Family Myeloperoxidase-like 0.0000000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015768   Gene: ENSGMOG00000014657   Transcript: ENSGMOT00000016171
Sequence length 623
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3573:46213:49620:-1 gene:ENSGMOG00000014657 transcript:ENSGMOT00000016171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPDLLPREDLEVLSKISGCAAMVSNPPCRTIQNLDKYRTATSVCNNLKNPRLGASNTPFK
RWLPAKYEDGKSMPKGWESDHSFNNFVLPLVRDVSNRILATTDEGVVNDREFSNMVVLFG
QWIDHDITFTPVSPSIRSFSNGLNCDESCERSEPCFPISIPPGDPRLPTGANSCIPVFRS
SAVCGTGYSAYNFGGVANKREQINALTAFLDMGQVYGSEDQLAKDLRDLTSDVGLLRVND
KYMDNGRELLPFSPLQANMCATRRKSTNNSTAEEVPCFLAGDVRVDENIALTSFHTLFMR
EHNRLARELKRINPQWDSETLYQEARKIMGAYSQVFVFRDYLPHIVGDEAMSGQLGRYVG
YNPNVDPSIANVFATAAYRFAHVALQPVLSRLDDNYREDARFPTVPLFKAFFSPWRLVFE
GGIDSLIRGLAGSPAKLGTQDNLMVDAVRERLFQFVQHLALDLGSINMQRGRDHGIPGYN
AWRKHCGLSEPSNQAELAQVLNNEGLATRLLQLYGTPSNIDVWLGGIAEPFVQGGRVGPL
FSCLISNQFKEIRQGDRMWYENPGVFTPGQKTALRDASLARIICDNTGISSIPQDPFSLL
SATNRLVHCSSIPRMNLSAWRKS
Download sequence
Identical sequences ENSGMOP00000015768 ENSGMOP00000015768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]