SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015899 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015899
Domain Number 1 Region: 138-392
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.42e-76
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00000000953
Further Details:      
 
Domain Number 2 Region: 395-544
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.01e-43
Family NADPH-cytochrome p450 reductase-like 0.00000364
Further Details:      
 
Domain Number 3 Region: 3-110
Classification Level Classification E-value
Superfamily Flavoproteins 3.54e-26
Family Cytochrome p450 reductase N-terminal domain-like 0.00000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015899   Gene: ENSGMOG00000014839   Transcript: ENSGMOT00000016303
Sequence length 546
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2880:118:13723:-1 gene:ENSGMOG00000014839 transcript:ENSGMOT00000016303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSYKVRFNSVSSYSDTRKSSSDEPEARVNFESTGPFANVRFSVFGLGSRAYPHFCAFAHA
VDTLFEELGGERILRMGEGDELCGQEESFRTWAKKVFKAACDVFCVGDDVNIEKANHSLI
SNDRSWKKSKFRLTYTAEAPTLTDLKSVHKKKVYGAKMIESQNLQTAKSNRSTIFVRLHT
NNHENLGYRPGDHLGIFPGNHEDLVMSLIDKLEDAPPVNQIVRVEFLEERNTALXXXXXW
TDENRIPPCTISQVFQYFLDITTPPSPVLLQQFASLATNEKQRNKLEVLSKGLQEYEEWK
WFNNPTLVEVLEEFPSIQMPSTLLLTQLPLLQPRYYSISSSPDVHPGEIHLTVAVVSYRP
RDGEGPIHHGVCSSWLNRIEEGEMVPCFVRGAPLFQLPKDHRVPCILVGPGTGIAPFRSF
WQQRLYDIENKGIESGSLVLVFGCRQSQMDHIYKEETIQAKNKEVFKELYTAYSREPGKP
KKYVQDVLREQLAETVYQSLKEEGGHLYVCGDVTMAGDVLKTIQHIVKLQGNMSHEDAGF
FISKLR
Download sequence
Identical sequences ENSGMOP00000015899 ENSGMOP00000015899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]