SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015950 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000015950
Domain Number - Region: 244-289
Classification Level Classification E-value
Superfamily Plexin repeat 0.000262
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015950   Gene: ENSGMOG00000014729   Transcript: ENSGMOT00000016358
Sequence length 430
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1820:34723:38012:1 gene:ENSGMOG00000014729 transcript:ENSGMOT00000016358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGERKSREVHAGDLTIDTLPDNMTHLVEDSRNYYTQRSFGPDDRRAGAFWVDMDDLQHGQ
VRMHGLLSNTHKQAARVALSFPFPFYGHYLKQITIATGGFIFMGDVTHRMLTATQYVAPL
MANFDPSSAKESTVQYLDNGEVFVVQWERVRLHGRDSEGEFTFQAALYRSGTITFSYRDI
PLSVEQIISGQHPVKAGLSDAFMVVKPSSKTADARQRTIYEYHRVQIDTAKITNNCAFEF
TALPSCLQHNSCVLCLSANQTLGCKWCHVLQRCSDGMDRHRQEWLDYACSEVKDDIRCED
YSRGETEASLRPSSKPDRATTGPILHDCKKYLDHVRCFPIPDVKSAIPKNTNRFASAGAT
AGVVAGVALLLALLVLALFLHRHPTPSHHLRQQRKNYWPSLKFHKQGLQPGYTEMEGNHD
REIIVENGKC
Download sequence
Identical sequences ENSGMOP00000015950 ENSGMOP00000015950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]