SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015957 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015957
Domain Number 1 Region: 78-257
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000317
Further Details:      
 
Domain Number 2 Region: 446-557
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015957   Gene: ENSGMOG00000014873   Transcript: ENSGMOT00000016365
Sequence length 565
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3000:567333:585466:-1 gene:ENSGMOG00000014873 transcript:ENSGMOT00000016365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQWKFSNSLLSRSPSSSSKDSAKAXXXXXXSCDPVCVTPCSLQAFRGQRSAAGNSRAGM
SRRTRVEGMWLEGEDFSQKAGFLHKPSQGWLHPDRKITGPGASYIVRYMGCIEVLKSMRS
LDFNTRTQVTREAINRLCEAVPGGKGAWRKKSLNKALLSIMGKSNLRFAGMSIAVNISIE
GLSLLIPTTRQVIAHHPMQSISFASGGDTDTPDYVAYVAKDPVNQRACHILECSDGLAQS
VISTIGQAFELQFKQYLHSPPKTMAPSMEXXXXLEEPSWGEEDDSSEHNYYNSIPGKEPP
LGGVVDSRLRPSTSLIGHIHTQPQSKAANQLCSSGRRDPGSFAAGQLCYELHWDTEASNS
SGTTLDGYLCADGQSSSSRDYEEHLYVNTQTLDGMDALTQGPNGHKGPDSPQKDIFDMRP
FEDALKLHEASGGGGAAGAGGRVLEDQWPSPPRRRAPVAPTEEQLRRESWYHGRMSRRDA
EKVLMRDGDFLVRESTTNPGQYVLTGMHCGLPKHLLLVDPEGVVRTKDMLFESISHLISY
HLKYELPIVAAESELHLQQVVRRKQ
Download sequence
Identical sequences ENSGMOP00000015957 ENSGMOP00000015957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]