SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015976 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015976
Domain Number 1 Region: 389-477
Classification Level Classification E-value
Superfamily EF-hand 1.32e-21
Family Eps15 homology domain (EH domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 57-80,150-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000812
Family G proteins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015976   Gene: ENSGMOG00000014910   Transcript: ENSGMOT00000016384
Sequence length 491
Comment pep:novel genescaffold:gadMor1:GeneScaffold_280:579:16145:1 gene:ENSGMOG00000014910 transcript:ENSGMOT00000016384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWVKQEQGGRNKEGEMYQTVTEGLQSLYSKKLLPLEETYLFHDFHSPALEPADFQSKP
MVLLVGQYSTGKTTFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXMPNQVLQSISIIDTGILSGEKQRXXXXYDFSEVLRWFGE
RVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSL
GKVINTPEVARVYLGSFWAKPLQNSENRRLFEAETQDLFRDIQGLPRNAALRKLNDLIKR
ARLAKVHAYIISHLKKEMPSLFGREKKKEELIMRLPEIYTILQREHHISPGDFPNVTKMQ
FEGSQDGPFGHGYGEGVSAGEDGEEWIVNRDKHRYDEIFYTLNPINGKISGVNAKKEMMS
SRLPNTVLGKIWKLADCDHDGMLDDQEFALAQHLIKVKLEGYEIPSELPAHLIPPGHRKD
PTADTLYPRVE
Download sequence
Identical sequences ENSGMOP00000015976 ENSGMOP00000015976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]