SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015992 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015992
Domain Number 1 Region: 41-142
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-24
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015992   Gene: ENSGMOG00000014918   Transcript: ENSGMOT00000016400
Sequence length 147
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2419:17736:19502:1 gene:ENSGMOG00000014918 transcript:ENSGMOT00000016400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQALPLRRYPPIRSLNFDLRVHVESLGHGVSGCPGLRISSRRCTGFLTKRGGRVKTWKRR
WFLFDMDHRRLAYYTDHDERKLKGVIYFQAIEEVYYDHLRTSSSPRPSLTFCVKTYERLF
FLVALSPEAMRIWMDVIVTATDEHSRY
Download sequence
Identical sequences ENSGMOP00000015992 ENSGMOP00000015992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]