SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016045 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016045
Domain Number 1 Region: 135-264
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-36
Family FKBP immunophilin/proline isomerase 0.00046
Further Details:      
 
Domain Number 2 Region: 16-141
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-35
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 3 Region: 366-475
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-35
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 4 Region: 263-379
Classification Level Classification E-value
Superfamily FKBP-like 5.7e-27
Family FKBP immunophilin/proline isomerase 0.00075
Further Details:      
 
Domain Number 5 Region: 484-555
Classification Level Classification E-value
Superfamily EF-hand 0.00000000416
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016045   Gene: ENSGMOG00000014984   Transcript: ENSGMOT00000016454
Sequence length 566
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1084:23584:34145:1 gene:ENSGMOG00000014984 transcript:ENSGMOT00000016454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMIQCVHAMFYLAVWVAFAACSAPPVPLDDIIIEKTFEPEVCGRAVKVGDYVRYHYIGTF
PDGKKFDSSYDRGSTYNVFVGKKQLIAGMDKALVGMCVNQRSLVKIPPQLAYGKGGYGDI
IPADSILHFDVLLLDVWNPEDGVQSTTYLTPPTCVRKVEVSDYVRYHYNGTLLDGTLFDS
SHTRLRTYDTYVGIGWLIAGMDQGLLGMCVGERRIITMPPSLGYGENGDAPGSDIPGQAS
LVFDVVLLDLHNPRDSIAVTNQVLPEPCPRKSATGDFVRYHYNGSLLDGTFFDSXXXXXX
XXXXXXXXXXXXAGMDEALIGVCMGERLTITIPPHLAYGEEGSKIPGSAVLVFDVHIIDF
HNPSDTTVMTVIHKPEECEKITKNGDFVKYHYNASLMDGSHIDSTHNYGKTYNIVLGANQ
VVPGMEEGLKDMCVGEKRHLVIPPHLGYGEGGVTDEVPGSAVLVFDVELVEVEEGLPEGY
MFIWNDDVSPDLFTEMDVDLDQQVEASEFTNYIMRQVTEGRGRLAPGFDPYRIIDNMFSN
QDRNGDGKITESEFRLKADEATHDEL
Download sequence
Identical sequences ENSGMOP00000016045 ENSGMOP00000016045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]