SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016071 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016071
Domain Number 1 Region: 182-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-57
Family DBL homology domain (DH-domain) 0.000000109
Further Details:      
 
Domain Number 2 Region: 383-538
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-38
Family Pleckstrin-homology domain (PH domain) 0.00000939
Further Details:      
 
Domain Number 3 Region: 96-176
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-18
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016071   Gene: ENSGMOG00000015009   Transcript: ENSGMOT00000016481
Sequence length 612
Comment pep:novel genescaffold:gadMor1:GeneScaffold_733:39914:53965:1 gene:ENSGMOG00000015009 transcript:ENSGMOT00000016481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPRPPLPSHDVPPYRAASARLRPSSAFSQSTPIGLDRLGRRRLHRVLSGVVYLVSGGVS
EGPALLDGSISEEEGSFDELMEVTPYLQPGVDLSLLNQWISSGHAVYAEALWDHVTMGEQ
ELAFEAGNVIRVLDASHEDWWWGRRAEQEAWFPSTFVRVRVNQEDFSSESVANQEGLAQL
RDPHSLQHLDQMRTNVVQEIMNTERMYIKHLRDICEGYIRQCRKHPTMFTEPQLLTIFSN
IEDIYRFQRQFLRELESKYNKEQPHLSEIGSCFLSQEEGFSIYSEYCNTHPTASAELHRL
MKLGRYKHFFEACRLLQQMINISIAGFLLTPVQKICKYPLQLGELLKYTPADHSDYGGVS
SAYGAMKNVASLINERKRRLESIDTMAQWQVSILHWEGADVLERSSELIHSGELTRVALQ
GAKSQQRFFFLFDHQLVYCKKDVLRRDLLHYRGRLDMDQTEVQELADGRDPGLGLTLRNA
LRLRNASTLEGLCILCCRKPQDKQRWLDAFARERHRVQEDQEMAGMEISEEQRQLAIFNA
RKLKQGKIKVPLAIGYSGSVPPHHQNLHPLHQRHVTVPTSVPQQPVFSLAEPPKRKPAHL
WHSITRSTLFKK
Download sequence
Identical sequences ENSGMOP00000016071 ENSGMOP00000016071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]